SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000004111 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000004111
Domain Number 1 Region: 432-721
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-82
Family Protein kinases, catalytic subunit 0.000000000144
Further Details:      
 
Domain Number 2 Region: 931-1061
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.31e-53
Family FAT domain of focal adhesion kinase 0.000000343
Further Details:      
 
Domain Number 3 Region: 153-274
Classification Level Classification E-value
Superfamily Second domain of FERM 9.68e-40
Family Second domain of FERM 0.000000427
Further Details:      
 
Domain Number 4 Region: 53-151
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.69e-39
Family First domain of FERM 0.00000213
Further Details:      
 
Domain Number 5 Region: 275-385
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-35
Family Third domain of FERM 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000004111   Gene: ENSPSIG00000003846   Transcript: ENSPSIT00000004134
Sequence length 1068
Comment pep:novel scaffold:PelSin_1.0:JH209032.1:588370:777098:1 gene:ENSPSIG00000003846 transcript:ENSPSIT00000004134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIYFLFSLFPEYDRYLASSKTMAAAYLDPNLNHTPSSSAKTHLSTGMERSPGALERVLKV
FHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKNVACYGLRLSHLQSEEVHWLH
LDMGVSNVRERFELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEI
ADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKT
LRKLIQQTFRQFANLNREESILKFFEILSPVCRFDKECFKCALGKKSSWIISVELAIGPE
EGISYLTDKGSNPTHLADFNQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIA
ENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKLANNEKQGVRSHTVSVSETDDY
AEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGVYMSPENPAMAVAIKTCK
NCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYS
LDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSTDCVKLGDFGLSRYMEDSTYY
KASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIEN
GERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKTQLSTILEEEKLQQEERMRMESRR
QVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQPNHYQVSGYPGSHGIPAMA
GSIYPGQASLLDQTDSWNHRPQEISMWPPTMEDTGTLDMRGMGQVLPTHLMEERLIRQQQ
EMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPAGNQHIYQPVGKPDHAAPPKKPP
RPGAPSHLGSLASLNSPVDSYNEGVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIE
MSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLLNSDLAEL
INKMKLAQQYVMTSQMLTAAHALAVDAKNLLDVIDQARLKMIGQSRPH
Download sequence
Identical sequences K7F7V1
ENSPSIP00000004111 ENSPSIP00000004111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]