SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000004130 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000004130
Domain Number 1 Region: 237-364
Classification Level Classification E-value
Superfamily Second domain of FERM 1.23e-30
Family Second domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 368-470
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-24
Family Third domain of FERM 0.0027
Further Details:      
 
Domain Number 3 Region: 17-101
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000197
Family PDZ domain 0.0082
Further Details:      
 
Domain Number 4 Region: 148-199
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000413
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000004130   Gene: ENSPSIG00000003886   Transcript: ENSPSIT00000004153
Sequence length 1694
Comment pep:novel scaffold:PelSin_1.0:JH224639.1:2227385:2307031:-1 gene:ENSPSIG00000003886 transcript:ENSPSIT00000004153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HVMPEESGDAMECGQLPSDALRQVTIQRDPLYGFGFVAGSERPVVVRSVTAGGPSEDKLL
AGDQIVAINDEDVSDAPRERFIDLVRSAKDFIVLTVLQTHQSPKSAFISAAKKAKLRSNP
VKVRFSEQVTVGETDPDMLKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMVTLQD
RLSLRYIEHFALVLEYSSPEQSHKFLLLQDKQPLAHVVQRTHYQGMRCLFRVSFFPKDPV
ELLHRDPAAFEYLYIQSRNDVIRERFGMDPKPETLLGLAALHIYITVSATRPTQKVSLKT
VEKEWGLEPFLPPSLLQLIKEKSLRKSLSQQLKAHQNQPPSGTKVSTTQAKLQYLRILNE
LPTFAGVLFNTVGLDEKQPATMLLVGPRHGISHVIDLKTNLTTVLSEFSKVSKIQLFREN
QGVARVETSILDAKPLVWLMEWPEATNFACLIAGYCRLLVDTKKMMFSRPSSQQLPPQIT
KADYITAHNVHRPAAAGHSGKKESGFLGGATSSPGKSSPRVPKASDSELVSFCYLHMREQ
RKQRENRTDINENLIFFEETRPRTKSDPTSKSSGQGYEGAAKEYNPDGLDRDHQASRARA
NTMDNHLRNDAMHFYCNSCKAKLKSRLASRKGGKAGSSHDNMVDLMSLPPPGSDEEADET
TSLLPAIAAPPPGFRDNSSDEDDPKRRAAAQSQEQGRHLCGILYDEIPVTLIDSVQTRTV
RDHAQELDDALVSTLQALEALAASEDCSHPPPQQTAGLIVLAAITPESSLDSGHETNSSE
LTDVSEMVSAMKQHQNAAYFLAHHINKENLLGRKDLPFRIQSCAAQAVLTSPYLLGRQEP
GPSLKPAFSHQPTSLSCSRSKQDQQPGEQSYTLAVQPVQSPQLKEQNRDMTMPGSECKGP
GHSKAAFEVSLHTAAALSRDQGQDPREKVPKEVRLSPKLTLDPKGSVTVSAALQQVGSKG
SPSQAAAVVADTQASGSSSCVLSSSKPLKFKGSQPAVETSCDCQPEASLSPKEPSGKRGD
ASHPSPGGGERLQAKTFPSKSYPQKVSGDPGGKPASGEPGQKAKSDAANPAYQKHMGPAS
QGEKMQQESCAKSLQAEGSTLHSPSTSGTSRSTSEDPKGQIQLVPRSEGLQISTVPSKKA
EKIPETTPQDADVPAKPKVPKAHFRLRKLFSATFPTRLKKETDERQAQLQKVKQYELEFL
EELLKPKTKSDLPPPEYLHPSVPGRCSCQLKSSPVQKVPGMSREQRRSCDCKRICRGVRP
QPGQLTAPELERQGREKAPDSQKQAEAGRLNSVSSPSKGRRIRSTSLESRDYRSDPENSM
SCLTTCTSRGECMGAPHYKKLMRRYSVSEIDQAERTSLSSDIYQNTYPAKQKGLQSEGDP
GTHSTTPKSKNQESPRTGDPSYVQIAQEKKSQKGSAAFSLQEEMYPSHAELPEEDMEDKK
CCSIRYCFYYRKCDVADDGSEKDELSYSIPMQILPGMKLDNQMVPVMSRTLQVLDATACS
SPDDSQTQEIDLRTSTFEGSLAKVHALRGHAYALPDGFLAVQLDTNELLTILRQCVVSPE
VRECKPYISQLAEYKQELALKFKEFRASCRRVAAVDKSPTHMLSAITSSFQVLSSLIETF
VRLVYIVRSESQRQELLTKVEEVVRNYTFLLRAAEESTARTLSQHQMAEQQSRPSATVAT
VMSTFTRSLKTLIN
Download sequence
Identical sequences K7F7X0
ENSPSIP00000004130 ENSPSIP00000004130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]