SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000004286 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000004286
Domain Number 1 Region: 2-730
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.57e-236
Family Motor proteins 0.00000000294
Further Details:      
 
Domain Number 2 Region: 2057-2169
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000236
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 3 Region: 1659-1739
Classification Level Classification E-value
Superfamily SH3-domain 0.000000354
Family SH3-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000004286   Gene: ENSPSIG00000004008   Transcript: ENSPSIT00000004309
Sequence length 2270
Comment pep:novel scaffold:PelSin_1.0:JH212636.1:1768664:1866275:1 gene:ENSPSIG00000004008 transcript:ENSPSIT00000004309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEDLSTLEEVCESSVLLCLKKRFHHNLIYTYIGQILVSVNPFKPLSLYLEEVVTQYQQGT
CSKNAPHVFAIAEMAYTLSQTSEQEQCIVISGHSGSGKTEAAKAIMRYLTTLYWQQDSHA
IRQPCDVLPILESFGNAKTILNDNSSRFGKFLHVHLRHGAVVGTSISQYLLEKSRVVFQA
CGERSYHVFYELLAGLSVEQKEQLYLHEAETYFYLNQGRACDLLGKQDDQDFVALVQALQ
VIGLSDDQLTSLWAVLAAILQLGNICFTSCEKESFGLAAIPSDTEIRIVANLLHVSAARL
QSAITHRVTVTSYDRIFTPLSVESAIDARDAIAKALYSLLFDWLLMKINEWLAPWEMDST
IGVVDIYGFEDLGVNSLEQLCINFANEHLQHFFRQTVITQEEEEYTQEELVWIPISMMHK
ESCLDLIAAKPHGILRILDDQTSLAQATDHTFLQKCHYHHGNSPWYGKPKLPSPVFTVQH
YAGPVTYQVHKFLNKNHDQLRPEVVEIFSQSHLQLVSHLFQQAKGHHTQQGELAMRGKGL
KLHVSTLVSRFQQSLQDLTAKLRRSHTFFIRCITPNPKKLSDIFDVEYVTCQLRHSGILE
AIHVRKEGYPIRILFQHFLVRYGTLMVPGQSCSEQRDRCAALLSHVVGHPSDLYQIGVTK
VFLKEKAKQLLERRWSQKQSWAIVTLQRNIRGLISRRQFQIFRQKVTIIQAHFRGHQARK
RYRRLKMMLVQLGMVVLISRPLVQTRKRWQQRCEDSRQRAESLARGGEERGSCPGMDVGL
LEIPAELAALLHSAKGKHHVQANQITEVSPPEVKAKCDLSLPPNINHSLFSAFIRSHFQE
PNFPALGQPLQQPLTRLEGEDKKSALEINKLILRFIGDRNLESWQEVLLGNYVASRGLGN
PALRDEILSQVLSQVWKNPDAEQSQRGYALLAAFLSAFAPSPELEKPLLKFVSDHGLEGY
NAVCQRKILTAMQTRPEVSRAHPPTLLEWTANQRRGKMVLDVFTYNEERFSAEVESWTTA
EQYAGWILGSRGLDKDPRGWAISMLSGEVWQDLLGCDFMLDLIGEMEEAGHSSADYPITP
EQGGGPFQSPSLDGSLTVPLTGRSGTSLQHQAFRRPLSLRHSCRRPSTPRASTQVSSPRE
WGRHSEESAATDPSQRVAEGAVGGLRSPKGLEHYVDNLFDPVLHQGSRVPGLENGRSLTE
RMKGGGKIGPTQQGAFPSAAMMAPQPVIPAVDPNQLAAQQAFINQQALLMAQQMTLQAMT
ISQQQQQQQQQQYSPAPAPAPASKPKKTYNSKKVAPAAAAEPVPAKVSPAATGFPPAAAE
PPAPPPAPKQKVQGKKEKEPHPGVAAFRPPKREPSREIRNIIKMYQSRPGPEPQPIEPVR
RPSKTFLKKNDPKNEALTKLGIISLEPPNSVGGPGVLAARCTLAWILPFQALPRGQAPAS
QPTPKHSGTARDLAEEEAGIKTQFYKLTASVSFSYAATPWKFFLRKEVFYPKENFSHPYY
LNLVPLQIMKDTYSESCIRISKEERLKMKDLLGSKSCIDTSRKLEDGIKKRIVVAARDNW
ANYFSRLFPVKGEHGSDVKLLGVSHRGLRLLKMANEPGFSPKYLKTLGQYSFADVLLVEL
KGSHSLEFSMKNEQLILHSAKAPQVKAMVELFLQELKQDSDYVIALRSYVTDDKSLLSFK
KNDLILLLPMQGLEPGECVDLSWAEWESTQVAGPGLGGWQFGSIGGRSGLFPASMVQPAA
APTYHNTHSEPGRGRYPGVGAQSFRTLKAVSLEPETPYAVFAPDADHYTMVEFATVHFRE
AQSTPGLKGVSAERRNPAALVEHTKVQLYRMMKELSDTETNELATRSFMTLMRFMGDQPT
LKSQPEIDCVYEILKLCKEKENLRDEVYCQVIKQLTQNPKPDSCIRGWQLLSLLTGFFLP
SSTLMPYVTKYLQEASADPVSIHHGTSCFPALAPCPSGGLTLCFPRQKGRGSRRMVITLP
GVLEYSTKIRTFTVAGEVVQEICEQMGISEQEEIQEFALFVSKSSGKVVRPIRQEEYVHD
YLLEDGSVMLELRRVAWKTPLHFDNEIYLSIHYSQVLQDYLRGKLLLNYNSDLEKQVGSM
ALVQHWAGALGSLPSTQELMDYVPKPALQRIDLQALQSQVKQLLETTEPLGQQDAKMEFI
ERVIQLPLFGYNVYPLERCSEPRIPLPSFLGVNRDEIVVVTSGSQELCCRIPLKEVQKMR
TLRPLEDSGAPGLEVNYGSAANPKTMWFELLQAKEMYHMITVLVEGESHP
Download sequence
Identical sequences K7F8C6
ENSPSIP00000004286 ENSPSIP00000004286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]