SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000004433 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000004433
Domain Number 1 Region: 6-161
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.31e-61
Family TRADD, N-terminal domain 0.00000538
Further Details:      
 
Domain Number 2 Region: 213-297
Classification Level Classification E-value
Superfamily DEATH domain 8.24e-16
Family DEATH domain, DD 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000004433   Gene: ENSPSIG00000004168   Transcript: ENSPSIT00000004457
Sequence length 304
Comment pep:novel scaffold:PelSin_1.0:JH208225.1:123130:144157:1 gene:ENSPSIG00000004168 transcript:ENSPSIT00000004457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSSELWIGSAYLFLQSTSEKIVLPSLYGSSQQKSSIFKALKLAFADSTGSLDGVDMLK
VHCSEPHLIIQLKFCVRENCRKFLRSYRAGLFRESLQNHLRVTLSVTAVSVEVELKTGSE
QLDHMLNEEERCLDYIYKEKPDRLRDEEIAELEESFRSLTCQQKSNNTNEYNSLNSSSLH
YCSGGSTLPAGATFIFQEQQFVNRTLTPDDHQKFAKLVSKKWKQVGRSLQKSCRALRDPV
IDNLAHEYDREGLYEQAYQLLLRFIQSEGKRATLQRLIAALAENSLISIAEDLLGLHHSE
NNTS
Download sequence
Identical sequences K7F8S3
ENSPSIP00000004433 ENSPSIP00000004433 XP_006121021.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]