SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000004818 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000004818
Domain Number 1 Region: 2176-2471
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.95e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000272
Further Details:      
 
Domain Number 2 Region: 666-774
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-32
Family Second domain of FERM 0.00026
Further Details:      
 
Domain Number 3 Region: 1339-1437
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-27
Family PDZ domain 0.0000725
Further Details:      
 
Domain Number 4 Region: 776-882
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-27
Family Third domain of FERM 0.0019
Further Details:      
 
Domain Number 5 Region: 1064-1164
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-26
Family PDZ domain 0.015
Further Details:      
 
Domain Number 6 Region: 1767-1855
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-22
Family PDZ domain 0.02
Further Details:      
 
Domain Number 7 Region: 1470-1580
Classification Level Classification E-value
Superfamily PDZ domain-like 3.02e-20
Family PDZ domain 0.022
Further Details:      
 
Domain Number 8 Region: 573-666
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.77e-18
Family First domain of FERM 0.012
Further Details:      
 
Domain Number 9 Region: 1860-1952
Classification Level Classification E-value
Superfamily PDZ domain-like 3.19e-16
Family PDZ domain 0.061
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000004818
Domain Number - Region: 2-149
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000142
Family Protein kinases, catalytic subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000004818   Gene: ENSPSIG00000004467   Transcript: ENSPSIT00000004845
Sequence length 2481
Comment pep:novel scaffold:PelSin_1.0:JH206739.1:305386:560466:-1 gene:ENSPSIG00000004467 transcript:ENSPSIT00000004845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLKEEEIWAVLNQSAESLQELFRKADPTDVSFIISPWSLLLLPSGS
VSFTDENVSNQDLQAFMAPEVLQNQSLSSLSDIEKIHVYSLGMTLYWGADHEVPQSQPIK
LGDHLNSILLGMCEDVMYARVTVRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGSLSGV
DQLSCNGERKLQTDRSQAIRDRLRGKGLPTGRSLMSDASEVHKTQFSQQAMLNKGLSKSM
GFLSISGAPGEGDFFRGMSSDYYSGHEDACCSYRCRTNNLKEKNNVGADNFAKWKVWASS
TDLLGTTDKATETDHSAESHRPNSHYEAVTVPTSATTRNKDSRYSDGSIALDVFGPQKLD
QVCPVPESSTSAAISCAFDRIRERQKKLQALREAMNVEEPMRRYKSYYSDVYSTSSESPS
IISSEPDFRQVKRNECLKRDDSGSALSGAEDISPSSQVHPLRSRQYEAAPEGNLISQEIM
LKRQEEEMVQLQARMALRQSRLNLCPGDLGRTSVLDITRDPLREIALETAMTQRKLRNFF
GPEFVKMTIEPFISMDLPKLNLTKKGKNEDTRRKVNVMLLNGQRLELTCDTKTICKDVFD
MVVAHVGLVEHHLFGLASLKDNEFLFVDPDLKLTKVAPEGWKEEPKKKGKDTVNFTLFFR
VKFFVDDVSLIQHTLTCHQYYLQLRKDLLEERMHCNDETALLLASLALQAEYGDYQAEVH
GMSYFRLEHYLPARVMEKLDLSYIKEELPKLHSTYVGASEKETEIEFLKVCQRLTEYGIH
FHRVLPEKKSQTGILLGVCSKGVLIFEVHNGVRTPVLRFPWRETNKISFSKKKITLQNIS
DGIKHAFQTDTSKTCQYLLHLCSSQHKFQLQMRARQSNQDTQDIERASFRSLNLHTESVK
GFNMGRAISTGSLASSTLNKLAIRPLSIEAEILKRLSCSELSLFQPLPGFSKEKNEKASW
EERPRAMSKSFHDLSQSQVSISPQQKNVISAVDSSQKMEELIGRLFQQRPKSDSGSVAGA
MKLNNSKSFSGLSRSLERKKNESDSSSIEDNGQAYVVVDTLQTTQPIVSSPEREIVLVNL
KKDEKHSLGFQIVGGEKTGKLDLGIFIHSVVPGGPADLDGSLKPGDRLISVNSMSLEGVS
HHAALEILENAPEDVTLVISQPKDKLDKVSSIHFANGTKTYLRRPSSMQDNEAESSSEEH
NRSRDHQRPISGSSSGLSVGKWDRSLNSQDSRTESANLSQSQTNGFFGNHIGDKAHLGLQ
HCSDSQSTISKPNEKKRNSADGIQTKAKRPGVVKTVDYSDRGDSDMDEATYSSSQEQQAA
KKESSSVNTANKMNSKKLSTAPLKPGDIFEVQLVKKDSGLGISVTGGVNTSVRHGGIYVK
AIIPKGAAEADGRIQKGDRVLSVNGISLEGATHRQAVETLRNTGQVVHLSLEKGQLPVAK
VHAPVTPQCTPPNQAGQSEPWNKPEKKLTHSKDYNFVTEDNIFEVKLLKNSSGLGFSFCR
EDSFTPDQLGSSIVRVKKLFPGQPAAESGQIEIGDVILKVNEASLKGLSQQEVISALRGT
SPEVSLLLCRPPPGILPDIDPSLLTPIHSPQHIFPDVSKETSCVSNGDQGDSSDEYEVTD
KSKKQLKSPSRRDSYSDSSGSGEEEVVVTPTQTASPGWNSALYQSLDKMMGPAQSQYETP
CTQEEEIRTIYYSAHETPSKPEFEDSNPPCPLPLDLPPIPSCRTVTEVAIPSLMDDAYIN
SISELVPQREKKTSLLSQFEKHTDDYEPEVELHVTMTKSEKGSLGFTVTKGNDNIGCYIH
DVIQDPAKSDGRLRPGDRLIKVNDMDVTNMTHTDAVSFLRAVPKTVTLVVGRVLELPKIP
VLPHLLPDITLTCHKEDLGLSLSGGHDSLYQVVYISDIKPRSVAANEESLHTLDIIHYIN
GISTQGMTLKEAKRALEMSLPKVVLKATRDGRPLVPKSRGSVSSSPRVMKANGHLPGDHY
GNIEIAPGIYVPEVHEENMIGVSHANAVSSIHQATGLMKFTDSRNMSSSGFTNQIQDFSK
NDDHSETEILDEDYYDADDHNEVVQYLLDVVDEEAQNLLNYNNGSPADSLETNGKLAEEK
AEDTDCDGSSLPEDFPEPTQINGCEEHCEDKVVSERSQQLLVGQADEDEITWGSDELPIE
SINQEHLAKVCPLVTNEELSALPIVRVLPSGKYTGAKLKSVIRMLRGLLEQGVPSQEIEN
LQDLKPLDRCLVGQTKENRRKNRYKNILPYDTTRVPLGTEGGYINASFIRMPVGNDEFVY
IACQGPLPTTVADFWQMTWEQKCTVIAMMTQEVEGEKIKCQCYWPDVLGKTIMVNDRLRL
ALVRLQQLKSFVIRVLELEDIQTGELRHVSHLNFTAWPDHGTPSQPDNLLTFISYMRHVH
KSGPIITHCSAGIGRSGTLICIDVVLGLISKDLDFDISDLVRTMRLQRHGMVQTEDQYIF
CYQVVLHVLKHLQAEEQQRGK
Download sequence
Identical sequences K7F9V8
ENSPSIP00000004818 ENSPSIP00000004818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]