SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000005374 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000005374
Domain Number 1 Region: 167-301
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-21
Family Third domain of FERM 0.0038
Further Details:      
 
Domain Number 2 Region: 66-169
Classification Level Classification E-value
Superfamily Second domain of FERM 1.01e-20
Family Second domain of FERM 0.00019
Further Details:      
 
Domain Number 3 Region: 2-64
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000269
Family First domain of FERM 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000005374   Gene: ENSPSIG00000005005   Transcript: ENSPSIT00000005405
Sequence length 544
Comment pep:novel scaffold:PelSin_1.0:JH212508.1:1722340:1742092:1 gene:ENSPSIG00000005005 transcript:ENSPSIT00000005405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKSSGKGLFHLSCSHLHLAEKEYFGLEFQSQAGHSVWLELLKPITKQTKNPKEVLFKFMV
KFFPVDPGHLREELTRYLCPLQIKKDLAVGRLPCSDNSAALLVSHLLQSELGDFHEETDT
RHLESHQYLPNQKYLDNKIMHYHQKHAARMLIACNDAHLLDIARKLEMYGIRPHPASDGE
GTQINLAVTHMGVLVLRGNTKINTFNWATIRKLSFKRKHFLIQLHANLSVWPSHPLLQVS
GSHVPFWSTFMEHHCYKRPSPLGLAVPGVSLSFLCSGRTQRQLLEHGRKGKAKSAPFERK
RYTARYHDRQCRSSPDLLTALSRHSSRPPGRPPEPAAPQVFFYVDRPPPVPRHTPASAEE
TGRGPGPMKPAKRSPGPARMKGLSPEALPWPCGVSRPLEEESWPLAGAFVHSPQEQPPKR
SWSQSDMKTLYFPYGSEFRPLGPRPALSSRKAGILRATLAQPTPAPAPRPGERCMGSGTE
SSDSDSDLLPADYYALYGRAGKSPLARVRLSSGSLQLDEEDEEVSGATRGAEARTSLGVS
NYFT
Download sequence
Identical sequences K7FBG4
ENSPSIP00000005374 ENSPSIP00000005374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]