SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000005548 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000005548
Domain Number 1 Region: 18-98
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.58e-37
Family PB1 domain 0.00014
Further Details:      
 
Domain Number 2 Region: 134-252
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-22
Family PDZ domain 0.00000293
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000005548   Gene: ENSPSIG00000005166   Transcript: ENSPSIT00000005581
Sequence length 384
Comment pep:novel scaffold:PelSin_1.0:JH211933.1:1451101:1551525:1 gene:ENSPSIG00000005166 transcript:ENSPSIT00000005581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRSFNKSQTLRYFDCSAVEVKSKFGAEFRRFSLDRYKPGKFEDFYKLILHIHHISSMEV
MIGYADVHGDLLPINNDDNFLKAVSSANPLLRVFIQRQDEVDYSNFGTNTLTRKKKALVT
LRNDKIRRRPHINISMPHDFRPVSSIIDVDILPETHRRVRLYRHGCEKPLGFYIRDGTSM
RITPHGLDKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANS
HNLIITVKPANQRNNYIRSSRMSGSSGQSTDSTASHHSLPSSHVLQNFHPDEMESDDEAD
IVIEGGLDQQHVPRSHSLPSGSLSRINGSSLSHRLQRDLVLSSDSGRESNGNIHKILSSL
KTDPRHSLVIPRGGIEEDGTVITL
Download sequence
Identical sequences K7FBY8
XP_006134066.1.96668 ENSPSIP00000005548 ENSPSIP00000005548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]