SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000005725 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000005725
Domain Number 1 Region: 297-439
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-39
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 193-298
Classification Level Classification E-value
Superfamily Second domain of FERM 5.76e-37
Family Second domain of FERM 0.00000284
Further Details:      
 
Domain Number 3 Region: 112-192
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.16e-26
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000005725   Gene: ENSPSIG00000005287   Transcript: ENSPSIT00000005758
Sequence length 1096
Comment pep:novel scaffold:PelSin_1.0:JH224666.1:1352643:1498147:1 gene:ENSPSIG00000005287 transcript:ENSPSIT00000005758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKDQDQDQQEAPAQQGTAGTQPQDQQQLSEEHQNAIDQFSAVAAHSTPVK
KEQVTEREQEFAAAAAKQLEYQQFEEDKLSQKSSCSKLSRSPLKIVKKPKNMQCKVTLLD
GSEYGCEVEKRSRGQILFDKVCEHLNLLEKDYFGLTYRDMENQKNWLDPAKEIKKQIRSG
AWQFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELG
DYDPDEYGGDYVSEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGV
DLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQ
FESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTRR
ASALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTKGISQTNLITTVTPEKKPEEER
DEEEGKKKGEEITPVSAIRHDTKSSLLGTDSFHSSSASQSGPHVSSTKLRRRCKENARKS
LSCESSKDIMQMHGESDLDSDRKGRVCSAEQDMPFSYKQKAGNGGTLFSFSLQLPESFPS
LLDDDGYLSFPNLSETNFLPESVQHYLPIRSPSLVPCFLFIFFFLLSASFSVPYALTLSF
PLAMCLCYLEPKAASLSASLDNDLSDSSEEETDSEQTDTAADGETTATESDQEEEGDLKA
QELDKNQEDLMKHQTNISELKRTFLETSTDTAVTNEWEKRLSTSPVRLATRHEEAPMIEP
LVPEETKQSSSEKTLDASNIFSLIESARKPTEFIGEVTSTSHSRAQRTEATTGQQISARE
MKQEIQSHQDAAKKVVQETVLVEERYMTNVHASGDAVKLAGNLLDAMAQAVSAEASSITG
KEGSAVTEGDKEKKREEADKAVAKQEEIAAASHLQEEEQSATVHVSDTLERKPHFESPIL
KTETISFDSVSPGGEKLEISSKEVPVVHTETKTITYESSQTDSGADSEPGVLMSAQTITS
ETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTK
VVVHKETEITPEDGED
Download sequence
Identical sequences K7FCG5
ENSPSIP00000005725 ENSPSIP00000005725 XP_006139074.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]