SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006229 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006229
Domain Number 1 Region: 41-131
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-26
Family PDZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 124-254
Classification Level Classification E-value
Superfamily PH domain-like 4.77e-23
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 3 Region: 271-399
Classification Level Classification E-value
Superfamily PH domain-like 0.0000477
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006229   Gene: ENSPSIG00000005702   Transcript: ENSPSIT00000006266
Sequence length 517
Comment pep:novel scaffold:PelSin_1.0:JH210982.1:896686:1156988:-1 gene:ENSPSIG00000005702 transcript:ENSPSIT00000006266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTKTGIALLYDEGSENAYDIQLKLTKEVLTIQKQDVICVSGSDHSTNHRTVTLHRQPVGG
LGLSIKGGAEHKVPVVISKIFKDKAADQTGMLFIGDALLQVNGINVESATHEEVVHLLRN
AGDEVTITVQYLREAPSFLKLPLGSPGPSSDHSSGASSPLFDSGLHLNGNTTNTAPSSPS
SPIANEPKYEKRWLDTLSVPLSMARISRYKAGTDKLRSNAFEVLALDGVSTGILQFYTAQ
ESADWLRALATNISDLTLQNMKMANKCCSLSDQVIHMGWVNERLEGTDSSQLYKYKFLAL
KGSSFYIFSTPPVSTLDWIRAEKIYHLCEVLFKVHKLWLADDCWLQANLYLGIHQDYAFE
DQRPYCFSVMVGHGKSHSFNVELGSELVAWEKSFQRAIFLEVQRTGSKTYMCSWQGVALC
FTVDFALGFTCFDSKTKNVLWRFKFSQLKGSSDDGKTKVKLLFQNIDTKQIEMKELEFQD
LTAVLHCIHSFIAAKVASLDPVFIDSQSIARKYMYSN
Download sequence
Identical sequences K7FDW9
ENSPSIP00000006229 ENSPSIP00000006229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]