SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006738 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006738
Domain Number 1 Region: 2-740
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.36e-266
Family Motor proteins 0.000000000171
Further Details:      
 
Domain Number 2 Region: 1146-1242
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-29
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 1326-1450
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-24
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 
Domain Number 4 Region: 1729-1797,1841-1885
Classification Level Classification E-value
Superfamily Second domain of FERM 1.05e-18
Family Second domain of FERM 0.0083
Further Details:      
 
Domain Number 5 Region: 1264-1318
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000367
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 6 Region: 1105-1147
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000767
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 7 Region: 745-883,1149-1174
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000858
Family BAR domain 0.026
Further Details:      
 
Domain Number 8 Region: 1889-1975
Classification Level Classification E-value
Superfamily PH domain-like 0.0000287
Family Third domain of FERM 0.046
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000006738
Domain Number - Region: 1634-1723
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0568
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006738   Gene: ENSPSIG00000006215   Transcript: ENSPSIT00000006776
Sequence length 1997
Comment pep:novel scaffold:PelSin_1.0:JH206751.1:26606:354261:-1 gene:ENSPSIG00000006215 transcript:ENSPSIT00000006776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHQTSVEGVEDMAMLGDLHEAAILLNLHQRYQQDHIYTNIGSILASVNPYKPISGLYTAA
AMDRYRQHHLGELPPHIFALANECYCCLWKRHDSQCVLISGESGAGKTESTKLLLKFLSA
MSQNAVGGPALEKSTHVEEAIMESSPILEAFGNAKTVYNNNSSRFGKFIQLHFSRHGHIQ
GGRVTDYLLEKNRVVHQNRGERNYHVFYALLAGVSGEQKEALCLSEPESYRYLHQSGCGS
DENLNDTEIFNKVMAALKVMEFSTEEIWDIFKLLSGTLQLGNIEFMTAGGAQVTGKAALN
SASELLGLDAFQLSEVLTQRSMFLRGEEISSPLTVEQAIDSRDSLSMALYSQCFSWLIGK
INMKIKGKENFKSVGILDIFGFENFEINSFEQFNINYANEKLQEYFNKHIFSLEQLEYNR
EGISWEAIDWMDNAECLDLIEKKLGLLALVNEESRFPKGTDNTLLEKLHSQHESNHYYVK
PRVTDHQFGIRHYAGQVLYNVRGFLEKNRDTFRDDILNMLKDSRLDFIYDLFERVPSRSS
EETLKMGTQRRRPTVSSQFRDSLHSLMATLSTSNPFFIRCIKPNMEKAPNLFNPDVVLNQ
LRYSGMLETVKVRRAGFPVRRLFQDFLSRYKMLMKDLSVPDNAKLTCADFLQMYDSTRSQ
WQLGKNKVFLKEALEQNLEKDREEELSKAAIVIRAHVLGYMARKKYQKALVSIVTIQKNY
RAHFWKKAFLRLKASAVVLQKHWRGQLARSLYQQLLQQEQRRKQEVEERRKQEEEEQIRR
EEEEKQWQEEEELRRKQEEEEEKKRQREQLDAILLMAQVEVLRTQEEEMPLQEEERRQME
EILRLEKEIEKLQQQQKADHMSITCENTKNEINRQREEEIQRLEKEASRVAQEFLELLDF
GNLDESVQVLEHSLSGDGTFSMDCGLVAPLAEEEVDEVFHADDEGLLAPSLVSDQHGTRT
TTNCSEEETPVTLPFLRRGEAEVDSTADHPVKSPEEHSAPSDTTECIYPSISETLRCNSV
EMGEPIYSFPQDEESDYDHEDFDGFGDTGSTSAEPLNGEETLRHSHGTSIDSNRGSLDSF
LDSEEEVDVYIDTDEEFCNGRVTIFNGSGPPYFHSYLYMKGGLMNPWKRRWCVLKNEAFM
WFRTKQEALKSGWLYKKGGGMSTLSRRNWKRRWFVLRESKLMYFENDSEEKLKGTIDIRR
AKEIVDIHEKENALDIVTEDRIYHIVAESPEDASGWFNVLSRVHSATAQQLREMQDEQAN
PKNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVIHCNSDTPEEMHHWISLLQKPKGE
AKIDGQEFLVRGWLHKEVQSSTKTSSLKVKKRWFVLTNTALDYYKSSERTATKLGTLVLN
SLCSVVQADERVFKETGYWNIIVHGRKHSYRLYTKLLNEAMRWASAIQGVIDSKIPIETP
TQQLIRDIRENSMNLEVVEQTYRRNPILRYTQHPLHSPLLPLPYGDVSHNMQQEKGYSSL
QDEALKIFNSLQEIETVSDPVPIIQGILQTCHDLKPLRDEVYCQLIKQTNHSPQPNSSGN
LHHWQLMSCMSCTCLPSRGILRYLKFHLRRVRDLFSGTEIDSYAQFISDSLKKTKTREFV
PSQEEILALITREEMTTTVYCHGGGSCKITINSHTSAGEVVEKLIRGLAMEDSRNMFALF
ERNQHVDRAVESRVIVADVLAKFERLAGSEEEDEEGQWQLYFKLYCFLDVENVPKEGVEF
AFMFEQAHENLIDGHFPAPEETLQHLAALRLQYLHGDYSKITWTLDGVYPVNRLKSKILH
STKSSSTASHALERRRTSFLEGTLKRGFKTGSVKKQKVEEEQMMEMWVKEELSAARASIV
QKWSKLQGLSQHQAMVKYMSIVKEWPGYGSTLFDVECKEGGFPNDLWLGISTENVSVYKR
GDPKALETFQYEHIVFFGAPQPNTFKITVDEREMFFETSQVGEIIKIMKAYINMIVKKRC
SVKSSASMDSPTSIWTS
Download sequence
Identical sequences K7FFC8
ENSPSIP00000006738 ENSPSIP00000006738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]