SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006868 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006868
Domain Number 1 Region: 96-119,206-310
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-30
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 2 Region: 110-205
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-21
Family PDZ domain 0.0073
Further Details:      
 
Domain Number 3 Region: 333-433
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-20
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006868   Gene: ENSPSIG00000006322   Transcript: ENSPSIT00000006907
Sequence length 455
Comment pep:novel scaffold:PelSin_1.0:JH206819.1:435901:472875:1 gene:ENSPSIG00000006322 transcript:ENSPSIT00000006907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDVNKTIKLPGDPVLKDTRASDSSQEEAIDRWARQRKQFKDSKKCSSTGGSSINSTITEI
SINSEESRSVDLSLRSENEESGFYTENFHSASWVFRGDDSSPDDSPRCLSRRPRPITVRE
RTVRITKGIGDYPWGFRIQFSKPILVTEVDTNSAAEEAGLQVGDILLAVNGNDVTSMPHS
QAANLARKGPDILTLLVGSDISRCPNTPRPTCRGYLHKRTHSGILKGWRKRWFVLKHDGC
LHYYKHKKDEGKCKPLDITKLEGAVIGVDSSLGKPFVFKCMPQTGNKIFYFCATSNQEMK
RWLEAMDKAVHPVHQNHVWVDVTLHNTSLPPLAIKNPECLGLLHQLDKSRDVWIQHYCIL
KDGCLYFYAGIRSTHAVGGIYLQGYTVSEQSLGSRRSVIEMKPPSEEFQTFYLCAENVNE
NKRWITALKISINKWITLNQAIQDFMNRPPEETKM
Download sequence
Identical sequences K7FFQ8
ENSPSIP00000006868 ENSPSIP00000006868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]