SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000006911 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000006911
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Fibronectin type III 3.49e-17
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000006911   Gene: ENSPSIG00000006345   Transcript: ENSPSIT00000006950
Sequence length 192
Comment pep:novel scaffold:PelSin_1.0:JH205757.1:22909:31301:-1 gene:ENSPSIG00000006345 transcript:ENSPSIT00000006950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPPSPVNVTVTQLKANSATVSWDVPEGDVVIGYAILQQRQDGQMQRFIREVNTTNRACVL
WDLAEDADYIIQVQSIGLHGESQASKRVHFRTLKATDRLPSNSSNQGDITVEGLDKERQL
QTGEIVIIVTVLLMWAAVIALFCRQYDIIKDNDSNNNKEKTKPSSEHSTPERPTGGLLRT
KKKSLSVNIIEV
Download sequence
Identical sequences K7FFV1
ENSPSIP00000006911 ENSPSIP00000006911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]