SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000007030 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000007030
Domain Number 1 Region: 199-339
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-39
Family Second domain of FERM 0.000000661
Further Details:      
 
Domain Number 3 Region: 496-583
Classification Level Classification E-value
Superfamily Moesin tail domain 3.92e-33
Family Moesin tail domain 0.0000211
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.18e-25
Family First domain of FERM 0.0000065
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000007030
Domain Number - Region: 434-477
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0131
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000007030   Gene: ENSPSIG00000006361   Transcript: ENSPSIT00000007071
Sequence length 583
Comment pep:novel scaffold:PelSin_1.0:JH207164.1:1065433:1149029:-1 gene:ENSPSIG00000006361 transcript:ENSPSIT00000007071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPSTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVRKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKLGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEEQTMK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRTAEEAKAALAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEASEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP
PTENEHDEHDENNAEASAELSSDGVMNHRSEEERVTETQKNERVKKQLQTLSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences K7FG70
ENSPSIP00000007030 ENSPSIP00000007030 XP_006117305.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]