SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000007103 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000007103
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000315
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 2 Region: 89-184
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000157
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000007103   Gene: ENSPSIG00000006506   Transcript: ENSPSIT00000007144
Sequence length 343
Comment pep:novel scaffold:PelSin_1.0:JH212598.1:2002466:2026970:-1 gene:ENSPSIG00000006506 transcript:ENSPSIT00000007144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNITIVNFNGELMQITWAAKDYYPDRNVTFFYRHSQNRVWKLCANYILDQGYNSGCFFKT
EGKTLTMSIKDKSGSKELFNRSLKTDFYIKPNPPENVTFHWQGDTLTVGCSKPKTKTKCL
KLELQYKSEYDKEWQSRKSVCCEVKEQGFDPEKCYSFRVRLERRTPICNVVPYSSEWGEV
TVWRNGSLIDSCADDIKPLANHAILLISVLAVLLVIVFLLIFVCKWQSYRFQKSIMPIIP
DPKHIFSDLFNDHNGNFQEWIHETDNAMAQTKMECIEHECIIEERTEQEDVKEASEKLYE
LSNMNKRDFLNSVHNTCLQPPASETVSFGSLNFFMNEDMYVIL
Download sequence
Identical sequences K7FGE3
ENSPSIP00000007103 ENSPSIP00000007103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]