SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000007306 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000007306
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-17
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000007306   Gene: ENSPSIG00000006728   Transcript: ENSPSIT00000007347
Sequence length 199
Comment pep:novel scaffold:PelSin_1.0:JH207279.1:387240:404165:1 gene:ENSPSIG00000006728 transcript:ENSPSIT00000007347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCFVSSDSPSAPVNVTVKHLKANSAVVTWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNT
TTRSCALWDLEEDTEYIVHVQSISIQGQSPASEPVLFKTPREAEKLASKNKDEVTMKEMG
KNQQLRAGEILIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKAKSPSESSTPEHQGG
GLLRSKFPKNKPSVNIIEA
Download sequence
Identical sequences K7FGZ6
ENSPSIP00000007306 ENSPSIP00000007306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]