SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000007415 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000007415
Domain Number 1 Region: 820-978
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.2e-40
Family Protein kinases, catalytic subunit 0.0000541
Further Details:      
 
Domain Number 2 Region: 446-693
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.33e-28
Family Protein kinases, catalytic subunit 0.00038
Further Details:      
 
Domain Number 3 Region: 311-415,450-477
Classification Level Classification E-value
Superfamily SH2 domain 1.94e-22
Family SH2 domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000007415
Domain Number - Region: 72-126
Classification Level Classification E-value
Superfamily Second domain of FERM 0.022
Family Second domain of FERM 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000007415   Gene: ENSPSIG00000006385   Transcript: ENSPSIT00000007456
Sequence length 991
Comment pep:novel scaffold:PelSin_1.0:JH211369.1:29982:51817:-1 gene:ENSPSIG00000006385 transcript:ENSPSIT00000007456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALRPTGILPVCHSLFALATEDLKCWFPPNHLFTVDNSSCQTVVYRIRFFFPSWLGPGKS
YRFGMLNDRSTAVLDCPTIDYLFAQSRSDFISGRMEVALSLQEQEECLSLAVLDMLRMAK
ERKWSPEEIFSCSSYKLRQQIQQHSFLTRKRIRRKFHKSLQKISSCKLKYLMDLEKREKT
WAVESFLGRAPRGGESGQEEYGIFWSHSGDEETQFFTSPPPSLPQNRQPFCDFPEIADIS
IKQVSRDSNPVENRLVTVTKTDNRILEVEDDGTRKNQSKVSLSTPVLGLTAAAHHYFCKE
VAPPRLLENMENQCHGPIKSEFAVEKLKLAGSSEGLYLLRRSPQDFDSYLLTVCIKTPFG
PDYKGCLIQRDKEGGYALSGVARCFSSLQELLRTYQHCTLHADGLALHLATCCPPRPKEK
SNLLIVRGSCCQLPGSPCAPRRSVNQMMFHKIQPEHLTWGENLGQGSFTKLYQGFWQDQE
DEESHKTQVLLKVMDASHGSCSESFLEAASAMSQISHKHLVLLYGVSIGEDSIMVQEYVR
YGALDTYLKKHRAGGQVAASWKLEVAKQLAYALNFLEDKRITHGNASTKKVLLAREGDAA
RGSPPFIKLGDPGVSLAMLAKERQGADPPVPRGETEARAAEAQLCTDKWSFGATLWEIFS
GGTMATSNLQPRQKLRLYQGLYRLGSPGLWSQCAKLTPVPLAAGWLQGMAPGGVHWPSSL
TFPHLSDYELLSDLAPSELPAKDGFWGYAKVPACQDPALFEERYLKYICVLGKVRPARPR
RQGRGGPVPPPPPPPPPPPRGPGAGCTRPELGSSVHFPALFQGMEYLGSQRYVHRDLASR
NILVENETHVKIGDFGLAKLLPQDKEYYVVREPGQSPVFWYAPESLSENVFSRESDIWSF
GVVLYELFTYSSRSRSPSEEFLRMMGLDKPLQVICHLLELLKDNKRLPAPPGCPPEVYGL
MQGCWAFSPSKRPQFSELGLKIEALRDSRSK
Download sequence
Identical sequences K7FHA5
ENSPSIP00000007415 ENSPSIP00000007415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]