SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000007425 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000007425
Domain Number 1 Region: 196-244
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.0000392
Family DnaJ/Hsp40 cysteine-rich domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000007425
Domain Number - Region: 110-150
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0274
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000007425   Gene: ENSPSIG00000006843   Transcript: ENSPSIT00000007466
Sequence length 247
Comment pep:novel scaffold:PelSin_1.0:JH211518.1:4004030:4020290:-1 gene:ENSPSIG00000006843 transcript:ENSPSIT00000007466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEGQAIRGPRESYGAIDQMPYAPPEGSFGAVVPDHTPSGEEPSAPPAYAIDDVSGYEG
TALGDDGGKDLPPPSNLVTDRGGGQHPPAQTHWNIPSISEDEAKEALMQYAARNCCYSSA
PAKEMVFRNLQPFNTYRYRLETFTESRSSEWKTSPYKGELVDSFLLGPAPLPWNIQVEVP
TMFTDNITKVKVPHTSSLQGCHNCRSSGTICCTNCHGRRKVQCWICHGSGNRLNDRCTHC
NGSGQSG
Download sequence
Identical sequences K7FHB5
ENSPSIP00000007425 ENSPSIP00000007425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]