SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008078 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008078
Domain Number 1 Region: 134-243
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000275
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008078   Gene: ENSPSIG00000007407   Transcript: ENSPSIT00000008120
Sequence length 257
Comment pep:novel scaffold:PelSin_1.0:JH212598.1:2094540:2109700:-1 gene:ENSPSIG00000007407 transcript:ENSPSIT00000008120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQLMHQACFCLALTWYKMISVCLANGHPSITASIMAPSDLHIVKNDFGVILSWNSNITE
EMETYSVKYVLMCKFDTAKEILERLQENKRIIRLGLHSGFYAKVKTQLLSKETEDVIKES
NWTEFVYKAPPVYIQNLSCIIYNLFNFNCTWDIKTEAPEDAQYFLSYRYSGKEFQCQLYL
INAKHKNIGCHMKEVYFNSSNPIRLNINVRVRSNSSENRSYYKRFTPRRLEKLNPPINVS
LSLEDRSIKINWRKKLF
Download sequence
Identical sequences K7FJ68
ENSPSIP00000008078 XP_006135915.1.96668 ENSPSIP00000008078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]