SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008261 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008261
Domain Number 1 Region: 474-755
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.4e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000751
Further Details:      
 
Domain Number 2 Region: 105-223
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-32
Family Third domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 354-446
Classification Level Classification E-value
Superfamily PDZ domain-like 7.36e-21
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 4 Region: 42-107
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000183
Family Second domain of FERM 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008261   Gene: ENSPSIG00000007499   Transcript: ENSPSIT00000008304
Sequence length 763
Comment pep:novel scaffold:PelSin_1.0:JH212603.1:1431978:1582618:1 gene:ENSPSIG00000007499 transcript:ENSPSIT00000008304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGVKLIFWEGLSKHTYMLKDVFMCCCLRLCILNKIVSGNCFFLIAQLGDYNSSVHHSGY
LSNYRFIPDQNKDFLTKVESLHEQHSGLKQSEAESCYINIARTLEFYGVELHSGRDLHNL
DLMIGIASGGIAVYRKFICTSFYPWVNILKISFKRKKFFIQQRQKHNESREHIVAFNMLN
YRACKNLWKSCVEHHTFFQTQKSLPHEKKILSHYWTFGSRNPTKRSPRLRHEIRKPRHSS
VDNLTNEIAYITETEDVFYTYKGSPTSKDSDSELFQNHSSQRRNVLENSPTQNCLTHTSP
VTLSQFPNGVGNLAGSHPLDGVDKQFLETYDNITKRSLTEDSSQYYCDKNEVIDGDLLLV
RITPDEDGKFGFNVKGGVDQKMPLVVSRITPGSSADKCIPKLNEGDQIVLINGRDISEHT
HDQVVMFIKASRELHTRELALLVRRKVVKPLVETKPEDETDSQNFLESILPTYSEYGDTL
EKSMEQLEKGLESGTVLIQFEQLYRKKPGLAVTCAKTAQNMDKNRYKDVLPYDATRIILQ
GNEDYINANYVNMEIPSAGIVNKYIATQGPLPHTCAHFWQVVWDHRLSLIIMLTTLTERG
RTKCHQYWPDPPDVMEYGNFRIKCQSEDCTIAYVFREMVITNIETKEEHTITHLQYVSWP
DHGVPDDSRDFLEFVTYMRPKRVENEPVLVHCSAGIGRTGVLVTMETAMCLIEKNQPVYP
LDIVRKMRDQRAMMVQTSTQYKFVCEAILRVYKEGLVRPLDSS
Download sequence
Identical sequences K7FJQ1
ENSPSIP00000008261 ENSPSIP00000008261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]