SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008410 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008410
Domain Number 1 Region: 30-137
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000746
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008410   Gene: ENSPSIG00000007695   Transcript: ENSPSIT00000008454
Sequence length 180
Comment pep:novel scaffold:PelSin_1.0:JH212622.1:1432265:1438953:-1 gene:ENSPSIG00000007695 transcript:ENSPSIT00000008454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRKAPVIPIDLDGALDTNASCSKLDSSLTKGLPGPPFICKHTVDDISAQVSWMAPFSRQP
VSFYQLVVQEVDVNSTDTATEKLNPWLLQIASTSVELRNLTPNVEYLVRVRAVTTAGAGE
WCKPYKFATLVPAGEGFSDPGHVTVTVCRKKDAHRKVICLDRCGREGLHGRSKSLRVWPS
Download sequence
Identical sequences K7FK50
ENSPSIP00000008410 ENSPSIP00000008410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]