SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008557 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008557
Domain Number 1 Region: 52-164
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-38
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 2 Region: 1-67
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-17
Family PDZ domain 0.00061
Further Details:      
 
Domain Number 3 Region: 187-298
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000752
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008557   Gene: ENSPSIG00000007782   Transcript: ENSPSIT00000008600
Sequence length 404
Comment pep:novel scaffold:PelSin_1.0:JH224641.1:2110756:2313276:1 gene:ENSPSIG00000007782 transcript:ENSPSIT00000008600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPILISKIFKGLAADQTQALYVGDAILAVNGTDLRDATHDEAVQALKRAGKEVLLEVKYM
REATPYVKKGSPVSEIGWETPPPESPRLGGVSSDPLSQLSLSIHRDRKTIPLKMCYVTRN
MAVSDPENRLLEVHSPDAKHTVVLRSKDSATAQAWFNAIHSSVSDLIPRVIAEVKDQLGK
TGIAGSREIRHLGWLAEKVPGENEKHWKPALVVLTEKDLLMYDSMPRMKEAWFSPLHTYP
LLATRLVHSGPTKGSPQSGVDLSFATRTGTRQGIETHLFRTETSRDLSLWTRNIVQGCHN
SAELITEIKTSCTYKNQECRLTIHYEHGFSLTVEPRDGALSKTIVQCPYEKLKMSSDDGI
RMLYLDFGGKDGEFQLDLHSCPKPIVFIIHSFLSAKITRLGLVA
Download sequence
Identical sequences K7FKJ7
ENSPSIP00000008557 ENSPSIP00000008557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]