SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008596 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008596
Domain Number 1 Region: 45-796
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.57e-265
Family Motor proteins 0.000000000167
Further Details:      
 
Domain Number 2 Region: 1211-1306
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-29
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 1390-1509
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-21
Family Pleckstrin-homology domain (PH domain) 0.0083
Further Details:      
 
Domain Number 4 Region: 1792-1862,1913-1949
Classification Level Classification E-value
Superfamily Second domain of FERM 3.26e-19
Family Second domain of FERM 0.0066
Further Details:      
 
Domain Number 5 Region: 1327-1382
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000367
Family Pleckstrin-homology domain (PH domain) 0.006
Further Details:      
 
Domain Number 6 Region: 1124-1211
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000986
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000008596
Domain Number - Region: 792-919,1213-1238
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00994
Family BAR domain 0.064
Further Details:      
 
Domain Number - Region: 1953-2039
Classification Level Classification E-value
Superfamily PH domain-like 0.0436
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008596   Gene: ENSPSIG00000007356   Transcript: ENSPSIT00000008640
Sequence length 2060
Comment pep:novel scaffold:PelSin_1.0:JH212596.1:176800:540816:-1 gene:ENSPSIG00000007356 transcript:ENSPSIT00000008640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNFYAEGSRVWLRENGQRYPSTVHSCAEGVVVFRTDYGQVFTYKQSTITHQKVTAMHQT
SVESVEDMAALVDLHEGSIMHNLFQRYQQNKIYTYIGSIVASVNPYKIIPGLYDHTAVEQ
YSKHHVGEIPPHIFAVANECYRCLWKRHDNQCVLISGESGAGKTESTKLILKFLSAMSQH
SLELSCKEKTSCVEQAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGRI
VDYLLEKNRVVRQNPGERNYHIFYALLAGIEEEEKDAFYLSLPEHYHYLNQSGCIEDMTI
NDKGSFKEVITAMEVMQFSKEEVREVLRLLAGILHLGNIEFITAGGAQVSFKTALSRSAE
LLGLDSTQLTEVLTQRSMILRGEEILTPLSIQQAVDSRDSVAMALYSQCFAWVIKKINSR
IRGKEDFKSIGILDIFGFENFEVNRFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLV
WEDIDWTDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNSFYVKPRVA
VHNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESKIDFIYDLFEHTSSRNNQDTL
KCGSKHRKPTVSLQFKDSLHCLMATLSSSNPFFVRCIKPNMQKMPDQFDQTVVLNQLHYS
GMLETVRIRRAGFPVRRQFQDFYKRYKVLMRNLTLPEDLTEKCAVLLHLYDNTCTEWQLG
KNKVFLRESLENKLEKQREVEITKAAMIIRAYVLGYMARKHYKKVLYYVVVIQKNYRAFL
LRRQFLHLKKAAITFQKQLRGQIARRIYRQLLEKKQKEEEKRRKEEEERERQRQEAEWLA
QQAKEERKQQDLAAIQKAQKEAELKQELQKQKENKQVEEILRLEKEIEDLQRMKEQQELS
LTEASLQRLQQLRDEELKRLEDEACRAAQEFLESLNFDEIDECVRNIERSLSVGSDYSAT
LSELTGNACSEKPNFNFSQPYPEEEVDEGFEADDDTFKDSPNPSEHGHSDQRTSGIRTSD
DSSEEDPYMNDTVVPTSPAASNTMLIAAGHHSLSLHNSSSGESTYCVPESVSCRPQNSEE
LISPEGDYDYDQDDYEDGAITSGSSITFSNSQSSQWSPDYRCSVGTYNSSGAYRFSSEGA
QSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVSLPYFHSFLYMKGGLMNTWKRRWCVLKD
ETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSRLMYFESDNEEKLKGTI
EIRTAREIVDNTGKENGIDIVMADRTYHLIAETPEDASHWFSVLSQVNGSTEQEIQEMHD
EQANPQNAVGTLDVGLIDSVCASDNPDRPNLFVIITANRVLHCNADTPEEMHHWITLLQR
SKGDTRVEGQEFIIRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALKLGT
LVLNSLCSVVLPDEKIFKETGFWNVTVYGRKHCYRLYTKLLNEATRWSSAIQNVTDTKAP
IDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDKG
YTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPNPG
SVGNLYSWQILTCMSCTFLPSRGILKYLKFHLKRIRDQFPGTEMEKYALFTYESLKKTKC
REFVPSRDEIEALIRRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNM
FALFEYNGTTDKAIESRTIVADILAKFEKLAATSDAGDVLWKFYFKLYCFLDTENVPKDS
VEFAFMFEQAHEAVIRGHYPAPEETLQILAALRLQYLQGDYSLHTTIMEIEEVYPLQRLK
SHIIQSTKMFTPTERIERKRASFLEGTLRRSFRSGSISKQKMEEEQMLDMWIKEEVSAAK
TSVIDKWKKFQGMNQEQAMAKYMYLMKEWPGYGSTLFDVECKEGGFPQELWLGVSADAVS
VYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSKVVDIAKLMKAYISMIV
KKRYSTSRSVSSHGSQNSSR
Download sequence
Identical sequences K7FKN6
ENSPSIP00000008596 ENSPSIP00000008596 XP_006135871.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]