SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000008934 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000008934
Domain Number 1 Region: 116-224
Classification Level Classification E-value
Superfamily Second domain of FERM 6.8e-29
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 2 Region: 226-367
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-24
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 3 Region: 16-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.34e-16
Family First domain of FERM 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000008934   Gene: ENSPSIG00000008033   Transcript: ENSPSIT00000008980
Sequence length 608
Comment pep:novel scaffold:PelSin_1.0:JH206845.1:1543077:1652236:1 gene:ENSPSIG00000008033 transcript:ENSPSIT00000008980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLNFQNNRVMQDRRSVCIFLPNDDSLNIIINVKIVCRELLVQVCDILRLRDCHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKISQKTWGIDQFGPPMIIHFRVQYYVENGRL
ISDRTARYYYYWHLRKQVLHSQCMLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPEAY
FPTWVLTKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDKRE
IEASLTLGLTTRGIQIFQNLDEDRQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKLIY
YTGCPLRSRHLLQLLSNSHRLYMNLQPVLRQVRKLEENEEKKQYRESYISDTGGLDMDQL
EKRSRASGSSAGSAKHKRLSRHSTASHGRSPXPRELGQEAGFLGPAVHRKLKTCSCRTSH
GSSHTSGVESGGKDRLEEDSQDDEIEMLVDDPRELEQTQDSPLEVSPDMCIYITEDMLTS
RKFNGHSGLIVKEVSSSTSSSSETVVRLRGQSSDSLPQTACRKPKTSTDRHSLSLDDIRL
YQKDFLQLADTAQSYTFGCGHELDEGGLYCNGCLAQRCINIQETFPVKRTSKYFSLDLTH
DEVPEFVV
Download sequence
Identical sequences K7FLM4
ENSPSIP00000008934 ENSPSIP00000008934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]