SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009143 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009143
Domain Number 1 Region: 546-634
Classification Level Classification E-value
Superfamily PH domain-like 8.36e-20
Family Third domain of FERM 0.0042
Further Details:      
 
Domain Number 2 Region: 362-454
Classification Level Classification E-value
Superfamily PH domain-like 1.09e-18
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 3 Region: 252-303
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000157
Family Second domain of FERM 0.013
Further Details:      
 
Domain Number 4 Region: 473-545
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000055
Family Second domain of FERM 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009143   Gene: ENSPSIG00000008127   Transcript: ENSPSIT00000009189
Sequence length 659
Comment pep:novel scaffold:PelSin_1.0:JH210532.1:49204:65273:1 gene:ENSPSIG00000008127 transcript:ENSPSIT00000009189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLKTASGDYIDASWELRVVVEELGTEAEPLTLRVTGDMHIGGVMLQIVNQMEVKQDWS
DHGLWWEQKKLWLLKTNWTLDKYGLQADARLRYTRQHKAVRLQLPNRRMIRVRASFSEPV
FRAVAGICRVLSIRHAEELSLLRAPEEKEKKKRKGPVLETEDEFDLGGVVLPASAEQQPF
RGMPAHFSDSPATEACYRMLSVSWAGLSPEHVLKMPRPSNLVEKAQINSRWLSSSRSLMQ
QDVRENEQLWLRFKYYSFFDLEPKYDTVRITQLYEQARWAVLLEETDCTEEEMMVFAALQ
YHINKLSLSADPTDQAKEQGLDDLDSALSNLQVKLEGGTSTSDMLENLTTIPELTAVLRV
FRPRKLTLKGYKPHWVVFKETTISYYKSREEALGEPVQQLNLKGCEVVPDVNISGQKFCI
KLLVPSPEGMSEVHLRCENEQEYAHWMAGCRLAAKGRTMADSTYQSEVQNILSFLQLQKA
NPDVPVAPDAEAMSTQWLVSPRYQKKFKPKQLTPRILEAHQNMAQLSLTEAKMRFIQAWQ
SLPDFGISYFVVRFKGNRKDEILGIANNRLIRIDLAVGDMVKTWRYNNMRQWNVNWDIRQ
VAIEFDEHINVAFSCVSAGCNIVHEYIGGYIFLSTRNVDKGRDLDEELFYKLTGGHEAL
Download sequence
Identical sequences K7FM83
ENSPSIP00000009143 ENSPSIP00000009143 XP_006129702.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]