SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009486 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009486
Domain Number 1 Region: 157-280
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-26
Family Third domain of FERM 0.0045
Further Details:      
 
Domain Number 2 Region: 57-159
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-24
Family Second domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 3-57
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000785
Family First domain of FERM 0.0018
Further Details:      
 
Domain Number 4 Region: 355-405
Classification Level Classification E-value
Superfamily RING/U-box 0.00000265
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009486   Gene: ENSPSIG00000008581   Transcript: ENSPSIT00000009533
Sequence length 419
Comment pep:novel scaffold:PelSin_1.0:JH212504.1:833205:855818:-1 gene:ENSPSIG00000008581 transcript:ENSPSIT00000009533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQVCRRLGIIEVDYFGLQFAGSKGESLWLNLRNRISQQMDGLAPYRLKLRVKFFVEPHL
ILQEQTRHMFFLHIREDLLAGNLQCSSEHAIELSALLAHMKFGDYNQNTAKYSYEELSAK
ELTTAILESITAKHKELEGLSQASAEYQVLQIVSTLENYGVEWHSVRDSEGQKLLIGVGP
EGISICKDDFSPINRIAYPVVQMATQSGKNVYLTVTKESGNSLVLLFKMISTRAASGLYR
AITETHAFYRCDTVTSAVMMQYSRDLKGHLASLFLNENINLGKKYVFDIKRTSKEVYDHA
RRALYNAGIVDLVSRSDQTPPNSPLKSSESNMNCDSCEGLSCQQTKALQEKLRKLKESML
CMVCCEEEINSTFCPCGHTVCCETCAAQLQSCPVCRSPVEHVQHVYLPTHTSLLNLTMI
Download sequence
Identical sequences K7FN76
ENSPSIP00000009486 ENSPSIP00000009486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]