SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000009728 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000009728
Domain Number 1 Region: 113-180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000292
Family Fibronectin type III 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000009728
Domain Number - Region: 64-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00221
Family EGF-type module 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000009728   Gene: ENSPSIG00000008846   Transcript: ENSPSIT00000009775
Sequence length 209
Comment pep:novel scaffold:PelSin_1.0:JH210903.1:1267628:1273013:1 gene:ENSPSIG00000008846 transcript:ENSPSIT00000009775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGALWPLNSTMYHIQTAEAKTYAGTLASQILIGLHQPTPLMKVSSLLKGIVKNVYEVIS
IDVQDVNECSHAELNACSRSELCINLEGYYKCIWEHEYMDGNSSQLQKECKDLSAIRDHR
IVNVTSSSFEVSWSVNSTLNHTFQVQVYKGQELLASMETTEMEMDISELEAGIKYTVKIS
YEACGKNIISYKNVKTGKYHLRNVAFFAI
Download sequence
Identical sequences K7FNW8
ENSPSIP00000009728 ENSPSIP00000009728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]