SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000010060 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000010060
Domain Number 1 Region: 1313-1477
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-67
Family Pleckstrin-homology domain (PH domain) 0.00000492
Further Details:      
 
Domain Number 2 Region: 1112-1312
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-53
Family DBL homology domain (DH-domain) 0.0000000725
Further Details:      
 
Domain Number 3 Region: 496-612
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-20
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 4 Region: 895-987
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000146
Family PDZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000010060   Gene: ENSPSIG00000009045   Transcript: ENSPSIT00000010111
Sequence length 1711
Comment pep:novel scaffold:PelSin_1.0:JH206637.1:5691853:5806598:1 gene:ENSPSIG00000009045 transcript:ENSPSIT00000010111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSESQYSLHGSKNHTTAASGAKQKPCSLKFHSGWGHSSSGTNYKSRSLARSCLSHFKS
NQPYSSRISDTVAKASKSNIHAKHRTNALGNYCQGNNAVFLPENGFHYIDREAASNHVAS
RDCNGHLLHCYGTNESLASTPPPEDRKSPKVLIKTLGKLDGCLRVEFHNSSNNKVSTEES
NGPVQLLRYSPTLESKSNDLLDVRRNSSTDDTSSHRLSPTDSRLRSSKGSSLSSESSWYD
APWGNNGDINELDGSYLTRSTPDTSIHASFPTNDSKKSFNQSSSLSSLRDLYKDTNLESS
PSSTLRLSDEYISTHASLSNRVSFASDIDVSSKVGHRGPTQYSSYTLPCRKSKPLNDDAS
KKDTLKSRMRRISDWTGSLSRKKRKLQEPKSKDLSEYFDSRIDNLTTDTLAPSQLSGLLW
SPGSGPILPQRSESTNAISSDALRQNIYENFMRELDMSRTNVENTDTSTETEDSSSESLS
SLEQLDLLYEKEQGVVRKAGWLFFKPLVTLQKEKKLELVARRKWKQYWITLKGCTLLFYE
TYGRNSMEQSNSPRYALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLFQATSQTDLENW
ITAIHSACASLFAKKLGKEDTIRLLKNQTKSLIQKIDMDSKMKKMAELQLSIVSDPKNRK
AIENQIQQWEQNLEKFNMDLFRMRCYLASLQGGELPNPKSLLAATSRPSKLALGRLGIFS
VSSFHALICSRDEAALRKRTLSLSQRVRSKKGLFSSLKGLDTLARKGKEKRPSVNQIFDS
TGGNGLTGTQLLQKSSSSSEQVDEMLNIYCSASESGQKESTWDIQTYVHFYDRLGVTLTL
KPEHRVEDILSLACKMRQLEPKHYGLQLRRLVDENNEYCIPEAYEYIQDQIYDEIEIFPL
NIYHVHLTKTENITDFGFAVTAQVVENQHLTHIFISDVLPDGLAYKEGLRVGNEILIING
EAVSDLDLRQMELLFSERSVMLTVRTSHGPKQASCMTWSDGVISMDPKNLLPPPNQSQLL
EEFLDNLKKNTANDADFSNVPDVTAGLKRSSTDGTLDQVPHKQKMDPPFRSTEQISTLCQ
NFLEVQANGMEGQKDSQDLPLRPLGRPLSDADRLRKVIQELMDTEKSYVKDLSCLFELYL
EPLQNETFLTQDEMESLFGSLPEMLDFQRVFLETLEDGISASSDFNTLETPSQFRKLLFS
LGGSFLYYADHFKLYSGFCANHIKVQKVLERAKTDKAFKAFLDERNPTKQHSSTLESYLI
KPVQRVLKYPLLLKELVSLTDNESEEHYHLTEALKAMEKVASHINEMQKIYEDYGAVFDQ
LVADQSGTEKEVTELSMGELLMYSAVSWLNPFPSLGKARKDLELTVFVFKRAVILVYKEN
CKLKKKVPNNARAAHNYGDLDPFKFRWLIPLSALQVRLGNTAGKGTENNCIWELIHTKSE
VEGRPETIFQLCSSDCEGKTNIVKVIRSILRENFRRHIKCESPLEKTCKDRLVPLKNRIP
VSAKLASTRALKVLKNSSSNEWNTETGKGNLLDSDECSLSSSTQSSSCHTTESMQESKNS
SPMKHCPSCTPDFSDSLVKESDILSDEEEDYQQSLTKGSPTRDIEIQFQRLKISEEPSAD
TEHKQPGADKAEDHPKLVRGHFCPIKRKANSTKHKGTLLAMQEHHHSLDGHADSANLDLN
SILEREFSVQSLASVVNEDCFYETVERHGKS
Download sequence
Identical sequences K7FPV0
ENSPSIP00000010060 ENSPSIP00000010060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]