SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000010616 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000010616
Domain Number 1 Region: 898-1150
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-60
Family Protein kinases, catalytic subunit 0.0000151
Further Details:      
 
Domain Number 2 Region: 592-877
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.86e-45
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 3 Region: 459-570,600-626
Classification Level Classification E-value
Superfamily SH2 domain 2.25e-17
Family SH2 domain 0.0042
Further Details:      
 
Domain Number 4 Region: 171-303
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000157
Family Second domain of FERM 0.0051
Further Details:      
 
Domain Number 5 Region: 390-449
Classification Level Classification E-value
Superfamily PH domain-like 0.00000848
Family Third domain of FERM 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000010616   Gene: ENSPSIG00000009400   Transcript: ENSPSIT00000010669
Sequence length 1169
Comment pep:novel scaffold:PelSin_1.0:JH209291.1:1984976:2028766:1 gene:ENSPSIG00000009400 transcript:ENSPSIT00000010669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYLNVKEDCKAMAFCAKLRNSKKSEVTTEAREQGLEIVFYLQEKPPIWYTSGEYTAEDL
CIEAAQKCAVSPLCHNLFALFEESRKLWYAPNHVFKIDDKTALRLYYRMRFYFTNWHGTS
ENEPSVWRHSPKKPKNSYEKKLVPYGAPILDTSPKKQKNSYEKKLVPDGTPILDANSLEY
LFAQGQYDLVKCLAPVRDPKNDQEVHEIENECLGMAVLAISHYAIKKNMKLPELPKDISY
KRYIPETLNKTIRQRNILTRIRINNVFKDFLKEFNNKTICDSSVSPHDLKVKYLSTMETL
TKHYGAEIFETSSLQISTENEKHGFNLGDNGIMPQYEVMVTGNNGIQWRRKPNVIQPERE
KHNKLKRKKMDSKNRKGEEKNKSREEWNSFSYFPEITLLVIKESTININKQNHEKMEIKL
SSHEEALSFASLVDGYFRLTADAHLYLCTDVAPPLIVHNIRNGCHGPICTEYAINKLRQE
GNEEGMYVLRWSCTDFNHILMTVTCSEISQQRLNESVQYKNFQIEVTKDGCFLHGPNKFF
PSLKELMDHLKGQTLRTDNISFTLKRCCQPKPKEISNLLVATKKGQEWHPVCPLGQLSFH
RILKEEILQEEHLGRGTRTQIYSGILNYKADENDGYQDEKEKKVLLKVLDPSHRDISLAF
FETASMMRQICHKHIVFLHGVCVRDVENIMVEEFVEFGPLDLFMHRKSDVLTTPWKFKVA
KQLASALSYLEDKELVHGNVCTKNILLAREGIDHEYGPFIKLSDPGIPITVLSRQECVER
IPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEAPLKDKTLAEKERFYEGHFMLVTP
SCKELADLMKQCMNYDPNQRPFFRAIMRDINKVEEQNPDIVSEKTPFAEVDPTLFEKRFL
KRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHE
NIVKYKGICIEDGGSGIKLIMEFLPSGSLKEYLPRNKSKITLKHQLRYAVQICKGMDYLG
SRQYVHRDLAARNVLVESENRVKIGDFGLTKVIETNKEYYTVKDDLDSPVFWYAPECLLQ
SKFYIASDVWSFGVTLYELLTYCDSESSPMAEFLKMIGPTQGQMTVTRLVRVLGEGKRLP
RPPNCPEEVNTRLLSKYTHTFLQVFKALF
Download sequence
Identical sequences K7FRF6
ENSPSIP00000010616 ENSPSIP00000010616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]