SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000011005 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000011005
Domain Number 1 Region: 1187-1929
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.4e-265
Family Motor proteins 0.000000000143
Further Details:      
 
Domain Number 2 Region: 3257-3374
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000215
Family Second domain of FERM 0.014
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000011005
Domain Number - Region: 2894-2935
Classification Level Classification E-value
Superfamily SH3-domain 0.000625
Family SH3-domain 0.0049
Further Details:      
 
Domain Number - Region: 3375-3470
Classification Level Classification E-value
Superfamily PH domain-like 0.000949
Family Third domain of FERM 0.027
Further Details:      
 
Domain Number - Region: 3177-3255
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0217
Family UBX domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000011005   Gene: ENSPSIG00000009590   Transcript: ENSPSIT00000011061
Sequence length 3490
Comment pep:novel scaffold:PelSin_1.0:JH209572.1:284766:381951:-1 gene:ENSPSIG00000009590 transcript:ENSPSIT00000011061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAGKGKEAAKGKGLARKEVAPPKSKMKKSLKSASKLFMGFKRLGLKRSKKGQFKNTSRFF
WGLKKYSTKKKKKSKNKAMLKSTSNLMMRFKSMGKKKEEVARGNLKKPSFLLLRLGGKRM
KAKFKPRAQILSKAAAATSWLTRKFLSKRARLPSNERSMNEAWLSRIGAKKLPFPSEDEI
LRHRANMRRFSGARRLCGQVEEEYGYQPYFEHGGFVRQPSGRFSQPGPSGYENPAASLDY
YNCYQDDSNFYDPPASAQYGYPEVESYLQAPADYADGYSFHNRRASDYEDYPEYEMEGDF
GLYEEPMDYYDDPLQNQPDYYDYEDQDYEPPSGYSPYEPYDQYRGDMDYYEEQTGPYGSF
EDQYGPSGGPYDLRGDEMGYLDDYSPQHEISYSECEWGPPAQSSYNPYAYPLDDITEMDE
PEELAEENGDYPFMLPNSSFFDQQGIEETLPSKLSLNRKFRLFPRPQVKLFGRDKLDIPL
PPSPHISLAGLDQDEDDYDEYESLAPPFAQAHGSRLPRPHSPKSVGSRFSPDVQQGNIQG
AHSQSFSPRGCGSPLGQFLQKSLTQPKPILKHRESVEESHVQHPLIEPSYKKFGHKLAGM
ETLDSAALLPRRKFGYTATNNNNSQGPPSPQPSRRSISSSPHPLSPEVPLPHPAPANSPF
LQPFGSHVTGKSPQLPSPRPPMRPRSPPPSPRSSLRMKSPTPAPSPSLRRLGSPARENVS
SPPLPRGQSFSTRGRTEPIDSTFQPTSSPSLPSPQPSLKSSSSRFQMFGSAPQGATLARN
LAPQRLHNFASGELKGPSLPHPSMRQFASPPEAMSPGFSARDAGSRQSSPQLSMEMHRRL
PQAWNRQPEPPTKAVKPLMRNSFLKQDSANFPPGWSPSPINTKGPSRELPAGPRRDGASE
NEIPAQQSASPKVAGGGSLRSISKLPPPPSPAPGAPKAFIKRIGQPLAGMTQMPLTETSS
MLAGRAGVREGGHVAQSQRPPSPTHPRHPLGRSPSQKPASPAPSLKHATMPMGEANKSRA
HLGLQSQRTVAFKGSHVVTATGPAFAGSPSLRKACSRPAKLPAELLENEDVSGEDGAGRY
AVVMPQVQRLGSFRRMSYLHKQHWSKQQMVNVHASPSVRSSEKLLHNPPAESFNRWSGQR
GDSAARYLTHRPSAQNRSDGNHWVRGSTGKTPPWHNKMHSLGSPPSASPRAEPKEDGVED
MTQLQDLQEGAVLHNIKTRFERELIYTYIGSILVSVNPYKMYNIYGTEQVLQYEGKALGE
NPPHLFAIANVAYTKLMDAKHNQCIIISGESGSGKTEATKLVLRYLAAVNQRRNVTQQFV
ILEATPLLESFGNAKTVRNDNSSRFGKFVELFLEEGLICGAITSQYLLEKSRIVFQAKNE
RNYHIFYEMLAGLPAQQKQQFCLQDAETYYYLNQGGNCEIPGKSDAEDFRRLLSAMEILN
FSTEDQNSIFRILSSILHLGNVYFEKYEADCQEVASVVSEREIRAVAELLQISPEGLQKA
ITFAAGETLREKIFTPLTVESAVDARDAIAKILYSLLFSWLTDRINKLVYPKKEALSIAI
LDIYGFEDLSFNSFEQLCINYANEYLQFFFNKIVFKEEQEEYIREQIEWKEITFSDNQPC
IDLIAQKPHGILRILDDQSSFPQATDHTFLQKCHYHHGSSALYTKPKMPLPEFTIKHYAG
KVTYQVHKFLDKNYDQVRQDVLDLFVNSKTKVVANLFFSHAQQVAQQRTMMGKNSTVTRR
YKAPTVAAKFQQSLLDLVEKMERCNPFFVRCLKPNNKKEPAVFEADIVSSQLRYSGILET
IRIRKEGFPVRIPFHIFIDRYRCLVDLWPDIRPDGVSCVEVLKKLCAVSPTMYCVGASKL
FMKEHVYQLLESKRDRALHRAALTLQHYARAFFIKKRFRSLRRKIVLLQSQARGYLARQR
YKRLRKSLIKFRSLVHVYVNRRRYLKRKEEARRRAEEEKRKAEQELTKREVVDVTHLEIP
AELAGLLELVAAHTPVPAQCVALAPVPTLQVDSQLTLPLDINNYPMAKYVRVHFQEPLFG
MLTVPLASPLTQLEEELVQEALALFKLILRFMGDPQLGGVQEDLFGNYIVQRGLTAPGLR
DELLAQVANQVWRNTNVNNEERGWLLLAACLSGFAPSASLEKHLLKFVSDYAFDGYRPVC
QHKLMRAMLKSQLGPEAARTYPPSLLEWTGSRQRASMALDVYCFNGDQFSCPIHSWSTGE
ELAGDVLKHRGLTEGWRGWSVSMKDGAQWAELAGHDYILDLVSDLELPRGFPKQKSYFII
ASEGAEEGSGATSAVFGQGLDSDEEVPPPPLTKAPTGPPPNTPGSEGYYCRGKRPALLWA
SFLQNSDTVSEPRMHKGLDRYLDSLFDPVLSYGNGDLEKPAAVSRKMKGGGQVGGGSSNS
SVDQSRARAPRETGFNVPLPGAAQLQMILRHRIVTAPLAQTLPHRALLAPREGTPRSSSP
GWDWAPPPMTYQLGGCAGPARPPGGNTQEQLTRLGLGATTNDLPAGRLPCPACCTPSPTH
PDSGSPDLWRWGRQGRKHGPRHVPEPRPLRGGGPSWGCWPGGKLKEGGKVFVKKRDPHEE
ALRILKGQMSGTPRAPVPKETVAMVKPVTSIRRPFRLLWPVAVSRELPGEQEQVQTQLHR
CCSEEFYTYRNVSWKIYIRKEVFYPKESINNPWLLDLLFRQIFHDTLSEACLRISPEERL
RMRSLFAENKLDSFSPVADDSVKKEIVLAARDSWEVYFSRLFPATGSVGTGVQVLAVSHT
GIKLACGSGNSSHQPGSALPKRSRGSYADLLFVTIPSKHMLEFNLSHEKLILFSPRAPQV
KAMIDYFITELKKDSQYVVAVRSHVTEDRSQLRFYRGHILCLREAIRFPAAAPALCQGSG
KRLEKLLSPRLRTRAPQAGWKFGAIHGKSGHFPTEYVQPAAGPAPLCTSHPLQPMVPLSQ
VSPAGSDYADNVEECGGELPGDSALQEGQFPMLDFAKKYFRESQRRKPESYKQKSRKGKD
SPDVAELLKFTKCPLQEALIDFPDSCLSRAAAEAFQAVMKFMGDWPLRGQTELDVVCAVL
KVCAEHEVMRDEVYCQVVKQTTDNTSPKTDSCQKGWRLLYILTAYYKCSEVLRPYLLQHL
QETCRSPGVHFQGIAKACTQNLRKTFQFGGRREFPSSMELKAMVAGRSAKRQLFLLPGGI
ERHLKIKTCSVALDVIEEMCDEMGLHRPEALEEYVIFAVTNGGQNVRPLSRREYILDVAT
EMELVDSSYMFWYRRVIWTQPLKFDNELYVTMHYNQVLPDYLKGLFSVLPPQQPSDQQRQ
QVSKLAALQHRAKDSIYLPTVREVQGYVPPQFCRALKPQSWLNMVLQHMPQVQALSAHQA
RAQFLGLLSAFPMFGSSFFYIQSCSNNAIVSPCILAVNQNGLNFLNKDTHELIVKFSLKE
IQSTRTQRPTAGSSYPYVEIMLGDLVSQRVTQLQLEQGLELCRVIATHVESLLCAREKRL
TLPPSEITLL
Download sequence
Identical sequences K7FSJ5
ENSPSIP00000011005 ENSPSIP00000011005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]