SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000011266 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000011266
Domain Number 1 Region: 93-198
Classification Level Classification E-value
Superfamily Fibronectin type III 1.66e-20
Family Fibronectin type III 0.00000553
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily Fibronectin type III 3.76e-19
Family Fibronectin type III 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000011266   Gene: ENSPSIG00000010131   Transcript: ENSPSIT00000011322
Sequence length 256
Comment pep:novel scaffold:PelSin_1.0:JH208850.1:886254:934017:1 gene:ENSPSIG00000010131 transcript:ENSPSIT00000011322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKEPVLMCRSNNYPKGFYCSWHLPSPTYIPNTFNITVMHGPRELVCEKDAFPKNRCHIRY
HQLFSTVKYKVTLTVTNALGHTHTALIFREFTIIKPDPPENVVAKPVANNPRRLEVRWQN
PSSWPDPESFPLKFFLRYRPLILDQWQHVELSDGTSHTITDAYAGKEYIIQVAAKDNDIG
TWSDWSVAAHATPWMEEPKHLTTEAQAAETTTSGTSSFLPPPTTKNCDLEAVVGSGATAL
TWAAGLGLAAAGILFI
Download sequence
Identical sequences K7FTA6
ENSPSIP00000011266 ENSPSIP00000011266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]