SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000012055 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000012055
Domain Number 1 Region: 84-185
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000101
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 2-94
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000145
Family Fibronectin type III 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000012055   Gene: ENSPSIG00000010846   Transcript: ENSPSIT00000012113
Sequence length 261
Comment pep:novel scaffold:PelSin_1.0:JH208881.1:226505:236019:1 gene:ENSPSIG00000010846 transcript:ENSPSIT00000012113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNLSCVNNYIKQVDCVWEPEKIGDENSSCTLAARDQLQSQLHCTMNRTDQLTEYESFRVS
LHGSFSGGDRAYVAFPEYKAKLNIKCDPPFNLQSNLSASLCRFQWSVPERLQKMLQFELS
YKKHGASWEQAQHKQLLSSATEVDIEAIEFEAGINYTARIRCKTSQEKNTYKSQWSEWSQ
TTEFRREGFREPRPSFGTSMIHMMFIPVCLVVILYIILNARLSSRAKNFFGLKVPTPAAF
FQPLYTLHNGNFKDWVGRNEA
Download sequence
Identical sequences K7FVJ5
ENSPSIP00000012055 ENSPSIP00000012055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]