SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000012328 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000012328
Domain Number 1 Region: 17-191
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.22e-51
Family DBL homology domain (DH-domain) 0.0000378
Further Details:      
 
Domain Number 2 Region: 177-325
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-32
Family Pleckstrin-homology domain (PH domain) 0.00063
Further Details:      
 
Domain Number 3 Region: 439-570
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.14e-30
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 342-454
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.01e-28
Family DEP domain 0.0028
Further Details:      
 
Domain Number 5 Region: 550-637
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000373
Family PDZ domain 0.023
Further Details:      
 
Domain Number 6 Region: 646-708
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000011
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000012328   Gene: ENSPSIG00000010894   Transcript: ENSPSIT00000012387
Sequence length 1597
Comment pep:novel scaffold:PelSin_1.0:JH211368.1:819015:971897:1 gene:ENSPSIG00000010894 transcript:ENSPSIT00000012387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLQAFLHRIRQNAVDNAEKYITEENVKILFSNIEDILDVHKAFLAALEFCLQPEPQSQHE
LGNVFLKFKDKFSVYEEYCSNHEKALRLLMELNKIPAVRAFLLSCMLLGGRKTTDIPLEG
YLLTPIQRICKYPLLLKELAKRTPSKHPDHQAVQNALQAMKTVCTNINETKRQMEKLEAL
EQLQSHIEGWEGSNLTDICTQLLLQGTLWTLLKISPGNIQERTFFLFDNLLVYCKRKSRV
AGKKASKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSHGYTVTNGWKIHNTAKNK
WFVCMAKTAEDKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMNKKVNLI
KDRRRKLSTVPKCFLGNEFVSWLTEIGEISKPEEGVNLGQALLENGIIHHVSDKHHFKNE
QVMYRFRYDDGTYKPRSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVIPASKL
VDWLIAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFYADEEMEGTSFKS
KQLRNDFKLIENILAKNLLILPGEDDYGFDIEEKNKAIVVKSVQPGSHAEMASLQVGRKI
YSINEDLVFLRPFQEVETILNQSFCSRRPLRLLVATKSKEIIKIPDCHEALCFQIRGAAP
PYIRAVGRGSKAAAVGLHSGQCILKVNGNNMMNENYTEVLEHFTAYRTVIIKRFEIHGLY
QWVYRTHEDAEEARAQQSAFNEEYVGRQVGITEGWSSNDLPLVPVSPLIMSEDMPLISLT
VDNVHLEHAVVYEYVSTAGIKCFVLEKIVEPKGCFNLTAKILQAFAVDDSHFVKNCKRLI
SQSRAVETMPEYDFRQTCDTKLESICKRLTSYYQFADELKTKVSPAFKQATMELHPFNSM
DFCPTNCHINLMEVSYPKNTTSAGRSFSIRIGRKPSIIGLDPEQGTLNPVSYTQHCITTM
AAPSWRCLSPEDGEPSPHEQYEGSFGQQNGGANQEERGLSFLLKQEDREIQDSYLQLFNK
LEIAVKEMKQYVIQINKLLSTITEPTGTCDSLPTEETSPPSLGAEESDTDKAEHGGIKKV
CFKVSEEDQEDSGHDTMSFRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPSD
MRIPSDKQDKLHGCLEHLFNQVDAINALLKGSVISKAFEETKHFPMDNNLQEFKQKEETT
IRCRNNIQFSVQEDPWNLPLSIKNLVETIQKHVEDGKNQLLLALLKCTDTELQLRRDVIF
CQSLVAAICTFSEQLLAALSYRYNNNGEYEESSRDASRKWLEQIAATGVLLHYQSLLSPS
VVRENLSVLEDISVTLSELDKVAFYFKELDESLVANTPVFYQIEGSRQALKIIFYLDSYY
FSKLPSRFQNGGSLKLHTVLFTKALESLESQSQPGDSSLEELQQQINGASLEKVQQYYRK
LRTFYLERSNLPTDSNTTAVKIDQLIRPINAMDELCRLMKSFINTKPPQSGYSSSNTSGA
GLLPISSELCYRLGACQIAMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRK
QGPRVEISAKNLKVMDQMPQSAPRLYRLCQPPLDGDL
Download sequence
Identical sequences K7FWB8
ENSPSIP00000012328 ENSPSIP00000012328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]