SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000012346 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000012346
Domain Number 1 Region: 42-224
Classification Level Classification E-value
Superfamily L domain-like 2.85e-38
Family Ngr ectodomain-like 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000012346
Domain Number - Region: 363-398
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00107
Family Fibronectin type III 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000012346   Gene: ENSPSIG00000011133   Transcript: ENSPSIT00000012405
Sequence length 551
Comment pep:novel scaffold:PelSin_1.0:JH208251.1:74571:77127:1 gene:ENSPSIG00000011133 transcript:ENSPSIT00000012405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFLCMWIAAFFGVSQGCPEPCTCVEKKFGRQLAECAYRDLQEVPAGLPSNVTTLSLSA
NRIRSLQQRSFLEVTQVSSLWLAHNEISAIEAGTFAGLLHLKNIDLSHNQLADFPWRDLH
NLSALQLLKMNNNQLARLPADAFRTLRDLRSLWINDNKLATIAQGTFDSLTSLSHLQIYN
NPLNCTCALLWLKGWAENTLISIPERDSISCAAPDSFRGLPLARVPGLRRGRPVCLQPRL
QPERPAQAARLCPGHHRAGRVGARGPGAAHALPRPARESPPAGALPVRRQRPGPRPGAVV
PGAGGSQLLLVPGLEPRHQLLGLPDAPGGGVPGAGGLHHEGGSPLPPHHRGRQHLPAGPG
HAPVQWSLVQEGVNSYWFQGLSPGTNYSVCLTHLGEECQVQVVFTTKAEVPSLLIIVAVS
IFLLALATVPLLGATCCHLLAKHQGKTYKLIMRAQNPDPMEKHMAADFDPRASYLESEKN
YNPSEAGAGAAGERELEREESLVAESIAECQSKANPEEFEVGSEYSDRLPLGAEAVNISQ
EINGNYRQPAR
Download sequence
Identical sequences K7FWD6
ENSPSIP00000012346 ENSPSIP00000012346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]