SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000012799 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPSIP00000012799
Domain Number - Region: 11-80
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000468
Family Fibronectin type III 0.0000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000012799   Gene: ENSPSIG00000011522   Transcript: ENSPSIT00000012860
Sequence length 80
Comment pep:novel scaffold:PelSin_1.0:JH212624.1:2992891:3015092:1 gene:ENSPSIG00000011522 transcript:ENSPSIT00000012860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASKGKLTIPKPNPPVVGEVTHHSIQLSWNVETTEQRKRPQEQWLKISIEEEDPKLHTY
GTIYSGYGRQHVVESLEPRT
Download sequence
Identical sequences K7FXN9
ENSPSIP00000012799 ENSPSIP00000012799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]