SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000012990 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000012990
Domain Number 1 Region: 140-272
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-40
Family Third domain of FERM 0.00051
Further Details:      
 
Domain Number 2 Region: 38-142
Classification Level Classification E-value
Superfamily Second domain of FERM 5.1e-33
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 2-35
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000537
Family First domain of FERM 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000012990
Domain Number - Region: 292-353
Classification Level Classification E-value
Superfamily DOPA-like 0.0942
Family DOPA dioxygenase-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000012990   Gene: ENSPSIG00000011694   Transcript: ENSPSIT00000013053
Sequence length 389
Comment pep:novel scaffold:PelSin_1.0:JH205821.1:14776:78965:1 gene:ENSPSIG00000011694 transcript:ENSPSIT00000013053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDASQVTHWLDHSKPIKKQIKIGPPYTLHFRIKYYSSEPNNLHEEFTRYLFVLQLRQDIL
SGKLKCPYDTAVELAALCLQAELGECEHPEHTPELVSEFRFSPNQTEAMEFDIFQKWNEC
RGKTPAQAELCYLNKAKWLEMYGVDMHVVKGRDGCDYALGLTPTGILIFEGANKIGLFFW
PKITKMDFKKSKLTLVVVEDDEQGREQEHTFVFRLDNAKTCKHLWKCAVEHHAFFRLRAP
ANSKSSRSDFIRLGSRFRFSGRTEYQATHGSRLRRTSTFERKPSKRYPSRRHSTFKANNP
VKAAQLCAKNNPEVHNYQQLYHPNMHPGQPHWHPHTPVNVRPPYHDDRPQWKPTTSGDDR
NIQYIQDQNQKNVGGIQSMMYQDKLMTTL
Download sequence
Identical sequences K7FY80
ENSPSIP00000012990 ENSPSIP00000012990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]