SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000013375 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000013375
Domain Number 1 Region: 33-222
Classification Level Classification E-value
Superfamily Fibronectin type III 1.39e-21
Family Fibronectin type III 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000013375   Gene: ENSPSIG00000012028   Transcript: ENSPSIT00000013438
Sequence length 244
Comment pep:novel scaffold:PelSin_1.0:JH207663.1:4407114:4428131:1 gene:ENSPSIG00000012028 transcript:ENSPSIT00000013438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYYMLNISAYNEAGESPQITYVVPDFTAKVLPGQVRVISQGNRSVVTWTPEYNPKCFVV
DWGTSKEDMHMKIITKPIRNFTLDHLQPYKLYRIMVHTSNICECESFVEHERTFGVTHFY
SVQGVPRTGPATVTISNVMKHSAIVKWTHIPQRDHLGFLQEYRISYIDIMKNHSLAVAVN
SSTTSYLLKGLKEKTAYRVQISGVTSAGEGARSHSQIFTTLKYGQENCAGQQYQIQETAA
RCKM
Download sequence
Identical sequences K7FZB5
ENSPSIP00000013375 ENSPSIP00000013375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]