SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000014597 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000014597
Domain Number 1 Region: 847-1124
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-72
Family Protein kinases, catalytic subunit 0.00000476
Further Details:      
 
Domain Number 2 Region: 528-819
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.52e-47
Family Protein kinases, catalytic subunit 0.0000744
Further Details:      
 
Domain Number 3 Region: 376-504
Classification Level Classification E-value
Superfamily SH2 domain 2.13e-17
Family SH2 domain 0.0032
Further Details:      
 
Domain Number 4 Region: 279-391
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000116
Family Third domain of FERM 0.018
Further Details:      
 
Domain Number 5 Region: 143-259
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000105
Family Second domain of FERM 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000014597   Gene: ENSPSIG00000012878   Transcript: ENSPSIT00000014665
Sequence length 1137
Comment pep:novel scaffold:PelSin_1.0:JH206693.1:734731:865080:1 gene:ENSPSIG00000012878 transcript:ENSPSIT00000014665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACLTMTEMEGTATSTLHQNGDILGNTNAPKQTETVLQVYLYHSPEKTEGHYLQFPAGEY
IAEEICAIACKACGMMPVYHNMFALMNETERLWYPPNHIFHVEESTRLNLLYRIRFYFPH
WYCNGSSRAYRYGVSRGAESPVFDDLVMSYLFAQWREDFVHGWIKIPVTHETQEECLGMA
VLDMMRVAKEKDQTPLAVYNSVSYKNFLPKCVRAKIQDYHILTRKRIRYRFRKFIQQFGQ
CKASARNLKLKYLINLESLQSAFYSEIFEVREPCRGPLGEESFATIVITGNGGIQCSRGK
HKSSEKLTEQELQTYCDFPDIIDVSIKQANQEGSSESRIVTSENRIVTIHKQDSKNLEAE
FHSLREALSFVSLIDGYYRLTADAHHYLCKEVAPPTVLENIQSNCHGPISMDFAISKLKK
AGNQTGVYVLRCSPKDFKKYFLTFAIERDGVAEYKHCLITKNEMGEYNLSGTKRSFGNLK
DLLSCYQTETVRSDNIIFQFTKCCPPKSKDKSNLLVFRSNGVSDVPTSPTLQRHNNVNQM
VFHKIRNEDLIFNESLGQGTFTKIFKGVRKEVGDYGELHQTEVLLKVLDKVHRNYSESFF
EAASMMSQLSYKHLVLNYGVCVCGEENILVQEYVKFGSLDTYLKKSKNSINILWKLEVAK
QLALAMHFLEDKSLVHGNVCAKNILLIREEDRKSGNLPFIKLSDPGISITVLPKDILLER
IPWVPPECIENPKQLSLATDKWSFGTTLWEICSGGDKPLGALDSPRKLQFYEDRHQLPAP
NWTELANLINSCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGAFGFSGA
FEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDF
EREIEILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYIQKHKERLDHKKLLM
YTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGE
SPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPVEFMRMIGNDKQGQMIV
FHLIELLKNNGRLPRPDGCPDEMYAIMTECWNNTINQRPSFREIALRVDRIRDNMGG
Download sequence
Identical sequences K7G2T9
ENSPSIP00000014597 ENSPSIP00000014600 ENSPSIP00000014597 XP_006115199.1.96668 XP_006115200.1.96668 XP_006115201.1.96668 XP_006115202.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]