SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000015242 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000015242
Domain Number 1 Region: 77-224
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-37
Family Third domain of FERM 0.00066
Further Details:      
 
Domain Number 2 Region: 2-79
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-23
Family Second domain of FERM 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000015242   Gene: ENSPSIG00000013638   Transcript: ENSPSIT00000015313
Sequence length 558
Comment pep:novel scaffold:PelSin_1.0:JH212208.1:1695722:1780609:-1 gene:ENSPSIG00000013638 transcript:ENSPSIT00000015313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCPINIAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEDAIERIHKTLMGQ
VPAEAELNYLGVAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVGKYFWPRI
TKVHFKETQFELRVLGKDCNETSFFFEARNKTTCKHLWKCCVEHHTFFRMPEHESNSLSR
KFSKFGSIGYKHRYSGRTALQMSRELSVQLPRPDQNVERSRSKTYPKRMAQTQQPGPKSI
NQVPGNMENGEEGTTKIIAPSPIKSFKKAKSENSPETQRSKTSAPWEENGHPSGLYNSPS
DHNKSPKFPNSRRRNPSGGSENEYGQHARRRKAQNSGEDSDLKHRRRSRSRCNTSSGSES
ENSNREHRKKRNRLRQENDMVDSAPQWEAVLRQQKEKNQADPNHRRSRHRSRSRSPDVQA
KEELWKHIQKELVDPSGLSEEQLKEIPYTKIETQGDPIRIRHSHSPRSYRQYRRSQCSDG
ERSVLSEMNAKADLVPPLPVTHSSDAQGPSIPASQQRQNGSKDSLIEEKSQISSSSLDGR
HRAKTIKTVHASRLKIET
Download sequence
Identical sequences K7G4N1
ENSPSIP00000015242 ENSPSIP00000015242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]