SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000015372 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000015372
Domain Number 1 Region: 323-467
Classification Level Classification E-value
Superfamily PH domain-like 7.65e-47
Family Phosphotyrosine-binding domain (PTB) 0.00000224
Further Details:      
 
Domain Number 2 Region: 495-604
Classification Level Classification E-value
Superfamily PDZ domain-like 6.31e-19
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 3 Region: 596-679
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-16
Family PDZ domain 0.0000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000015372   Gene: ENSPSIG00000013754   Transcript: ENSPSIT00000015444
Sequence length 687
Comment pep:novel scaffold:PelSin_1.0:JH211382.1:287546:303675:1 gene:ENSPSIG00000013754 transcript:ENSPSIT00000015444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPACEGTLGGLQSPGSSDLPDAGEAREEACRVPGGGMDAAAAGSDSGCPRALASTEQS
DLVCMDLDEAPEAHLGREEWAETVGEDGQSEIQGLLTQLQSLSPSFHDDLPASEGDPLLA
SDCGAGPHGGEVPLPHRRAVGCCQGLPGECSPCLLHVATGRGLGVLPCRARCSTSSRRSH
GLLFAEADREDLLSLLHHEGGLPAEGSEETPLARSDSLAGSDAAALLHRESPVARQMEEA
ASQAGSPQAEGSCRWYRTRGACEEDPACATPGSRDSSPEPVWAAMSAPPSQGPEQAPHGS
TAAKEALASYPAFKEVAGPCEPEDLLDGVIFGAKYLGSTQLVSERNPPTSVHMAQAQEAM
DRVKAPDGESQPMTEVDLFVSTQRIKVLTADSQKAMMDHPLQTISYIADIGTILVVMARR
KLPRRADASGEKRLYKMICHVFHSTDAQLIAQAIGQAFSLAYQQVLQASGIDPSQLPPRQ
DSCALESRELHNGDLAHFSKQENCRDICIHKQKGEILGVAVVESGWGSILPTVVIANLMH
GGPAEKCGELSIGDRLMSVNGTSLVGLPLGTCQNVIRDLKSQTEVTLSIVHCPPVTTAIV
RRPDSKYPLGFCVEDGIICSLMRGGIAERGGIRVGHRIIEINGRSVVATPHEKIIQILTQ
AVSEVHIKTMPASTYRLLTGQEQPIFL
Download sequence
Identical sequences K7G511
ENSPSIP00000015372 ENSPSIP00000015372 XP_006132662.1.96668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]