SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000015417 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000015417
Domain Number 1 Region: 368-556
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-63
Family Regulator of G-protein signaling, RGS 0.00000969
Further Details:      
 
Domain Number 2 Region: 764-992
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-63
Family DBL homology domain (DH-domain) 0.00000000197
Further Details:      
 
Domain Number 3 Region: 993-1127
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-40
Family Pleckstrin-homology domain (PH domain) 0.00000208
Further Details:      
 
Domain Number 4 Region: 40-149
Classification Level Classification E-value
Superfamily PDZ domain-like 1.1e-21
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000015417   Gene: ENSPSIG00000013776   Transcript: ENSPSIT00000015489
Sequence length 1540
Comment pep:novel scaffold:PelSin_1.0:JH211802.1:1050202:1157179:-1 gene:ENSPSIG00000013776 transcript:ENSPSIT00000015489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGTQSTITDRFPLKKPTRHGSILSRETPADKKQKVERCSSTHDFDPTDSSSKKTKSSSE
ESRSETYGLVQRCVIIQRDENGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNG
TLVTNSNHGDVVKLIKSGSYVALTVQGRPPGSSQIPLADSEVDPAAFGHMSPIMTSPHSP
GTSGNAERITSPVLMGEENNIVHNQKVEILRKMLQNEQERLQSLQEDYSRTPTPRLLKEI
QETKKHIPQLQEQLSKATGSTQDGVLFSRPVTESLQISEGEAESGDGLSKLDYSSGDGSR
PNSDIADSPRSGPKERIYLEESPEKSEIQDTDSQSSVGSPSSRMAPQIIGAEDDDFDTEQ
EQINGQCSCFQNIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYTDLYKQTNSKETRRVF
LEFNQFFLDRAANLKVPVPDEISVDLEKRRPELIPEELHRHYIQTMQDKVYPDVQRHLED
FRQKRSMGLTLAENELTKLDAERVRDRITLEKERACAEQIITKIEEVLLTSQPLEEDKSS
AMQYVILTYMKNLGVRVKEPRSLEQKRGRIGFLPKIKQSIKKEKEGEEKVKRRGFTSILG
PQRRPSRHDSSAIGRAMEIQKQRHPKHLSTASSVSPEPQDSVKMRQSGSSSDGTETCPPA
NPMSPLAMGPFASPDGSKENDTGPKQSGEAPPLSDSTDGAPRTPNTIFEFPSPPLDQLQE
EEGELDRLADLGTPKLFRKTDSVGFGDIQSEDELFDFDTETDPPNWQQLVSQEVLLGLKP
YEIKRQEVINELFYTERAHVRTLKVLHQVFYQRVLREGILTPSDLRKIFSNLEDILLLHT
GLNDQMKAVRKRNETSVIDQIGEDLLTWFSGAGEENLKHATATFCSNQPFALEVIKSRQK
KDSRFQTFVQDAESNPLCRRLQLKDIIPTEMQRLTKYPLLLDNIAKYSERPEEKEKVKKA
ADHCRQILNYVNQAVKESENKQRLEDYQRRLDLSYLKQSEYPMLDEHRNLDLTKRKMIHE
GPLTWKVNRDKTIDLYTLLLEDILVLLQKQDDKLVLRCHSKILASASDIKHTFSPVIKLN
TVLVRQVATDNKAFFVISMSENGAQIYELVAQTVSEKTVWQDLIAEMAGTVKVEASKRPI
PLPQSGPGDEEHEEEEQQKLKEEQRDIPASSMQSPDTDLGIEPPLMLKAQSPSAIMAEKS
EGEEDPDAENHFERDQQTELTVGESSAHPEPAVPLQISEERWALNALRDLGLLKQLLMQH
LGMSEKGTLEGWQRFPKFRTVSRGAQAQSGVQDGLQPSDDKMQQSGTDGMHPRTGANESS
ACYGLRTSAEFPASQDAVQLGSRHTRSSNSLVTDHVSMTLETPATELEGGGADDNGEHFF
DAHEAHSDETPLEGEVMERKEEEEVHIRISGNYLILDGYGTVQESSTDEEVSSLVLQYTA
GHSSLDSANQQPVSPQDAQSDEGSSSFPEEFMASRWAQVDELCSDVQSPHFSVESRIQVM
QYIQKIEANLEHLKEVEENYATLLRQRPTGSAPTDEHSGT
Download sequence
Identical sequences K7G556
XP_014434315.1.96668 ENSPSIP00000015417 ENSPSIP00000015417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]