SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000016541 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000016541
Domain Number 1 Region: 1241-1402
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-75
Family Pleckstrin-homology domain (PH domain) 0.0000000731
Further Details:      
 
Domain Number 2 Region: 1038-1244
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-48
Family DBL homology domain (DH-domain) 0.00000000862
Further Details:      
 
Domain Number 3 Region: 461-583
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 849-927
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000333
Family PDZ domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000016541
Domain Number - Region: 772-808
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0889
Family Ras-binding domain, RBD 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000016541   Gene: ENSPSIG00000014519   Transcript: ENSPSIT00000016617
Sequence length 1597
Comment pep:novel scaffold:PelSin_1.0:JH209475.1:5057621:5285458:1 gene:ENSPSIG00000014519 transcript:ENSPSIT00000016617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAESQNVEHALYGDKHASLGRKHTSRSLRLSNKASRRTRHASSGKIIHRNSEVSTRSS
STPSIPQSLAENGLEPFNQEANLEDFGSPIWVDRVDMGLRPVSYHTDSSVTPSVDSSTVL
TAASVQSMPDTEESQLYGHDTTFLAEEDGRQHRYATNGTSFMETASFKKKRSKSADIWRE
DSLEFSLSDLSQEHLTSNEEILGSAEEKDGEGIRGTEASNSPQQLVTCQRANSLSDLYSP
KNSNATINGGPRNTFGGYCRNLVSDIPDIGNRKMASATTEDTPSYSNYNTLPCRKSHCLS
EGATNLQLSHSNSMQGRRAKTAQDVNAGEGSEFADSGIEGATTDTDLLSRRSNATNSSYS
PTASRAFIGSDSGSSSAGDGHRQGVYENFRRELEMSTTNSDNLEEVGSTLSDEQSSGTLS
SPGQSDILLTASQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYE
GDGRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTSSQTELENW
ITAIHSACATAVARQHHKEDTVKLLKTEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKK
TILDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFS
VSSFHALVAARTGESGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGE
GVDSAKKSLEGIFDDAVPDGKREKEVPLTSTHQHNPECDIWVHEYFTPSWFCLPNNQPAL
TVIRPGDTTRDVLEMICKTHQLDHSAHFLRLKFLIENQMQFYVPKPEEDIYELLYKEIEI
CQKITQHMQIEKSDSSSDFYGFSVSSVEEEGFRRLYVNRVKETGLAFKKGLKVGDEIIEI
NKRVAEDLDSTRLKDVLIQPSLCLTVRTYPEIEEGQKLMQPPQRRMENQSDLSDSALTYI
GSNQGHMLCSEQDSCAEATPEEAEMPDLESSDETDRMSKSTEQVAAFCRSLHEMNPSDSS
LHPQEFTGPQLSTMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQ
DELDVLFGNLTEMVVFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADR
FKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRRQHSSTLESYLIKPIQRILKYPL
LLELLALTDADSEEHYHLDVAIKTMNKVASHINEMQKIHEEYGAVFDQLIAEQTGEKKDV
ADLSMGDLLLHNTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLGGSHR
ASIYEDWDPFRFRHMIPLEALQVRAPASADAETNSVCEIVHVKSESEGRPERTFHLCCSS
PDHRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMNRAVSAP
SKSLGRRRRRLARNRFTIDSDAVFESSPEKESQQPTASGDTDRWVEEQFDLAQYEEQEDI
KETDILSDEDEYCESTKGITVDKELQERLQAASITSSQSRRADKARHAIGTHASRMTQLK
KQAALSGINGSVESNSEEVIWVRREDFVPSRKLNTEL
Download sequence
Identical sequences K7G8D0
XP_014430528.1.96668 ENSPSIP00000016541 ENSPSIP00000016551 ENSPSIP00000016541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]