SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000016876 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000016876
Domain Number 1 Region: 682-829
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.58e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1010-1110
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.17e-29
Family Ras-binding domain, RBD 0.00082
Further Details:      
 
Domain Number 3 Region: 216-369
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-22
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 4 Region: 17-99
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-19
Family PDZ domain 0.012
Further Details:      
 
Domain Number 5 Region: 955-1024
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000537
Family Ras-binding domain, RBD 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000016876   Gene: ENSPSIG00000014932   Transcript: ENSPSIT00000016954
Sequence length 1422
Comment pep:novel scaffold:PelSin_1.0:JH210093.1:7948363:8106745:-1 gene:ENSPSIG00000014932 transcript:ENSPSIT00000016954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRPGDTVKRRLNIHASPRIRSVEVARGRAGYGFTLSGQAPCVLSCVMKGSPADYVGLRA
GDQIFAINEINVKKASHEDVVKLIGKCSGVLHMVIAEGTSHIDSCSSDEEVGFYDGKGWL
KPKPDSKVLGINRAEKVVEEMQSGGIFNMLFENPSFCACNVDNSVPKQRSLSETAAIKFE
IGHEHINNNPNLLSKEEISKVLHDDSVFQIGPENPEDFALDASILNVAMVVGYLGSIELP
STSSNLENDSLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCSDKSGVVAEYPAEKLAF
SAVCPDDRRFFGLVTMQTNDDASLAQEDEEVLRTSCHVFMVDPELFHHKIHQGIARRFGL
ECTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNSTSSN
SDSGIGNFNQEEKSNRVLVVDLGGNPSKHIPNSIWENPVVRGQNQHTSQWNSFCHEQEGS
TPLEVIQNDKSQSKHLSPSARIEVPLVSSRSSVPPSKKSTIGVGNQRWLPVHVLREWQHG
NASDQESYTDSTDGWSSVNCGTLPPPMNKIPADRYRVDGSFGQPQLTSHKNEWSKKVFCA
HNKFGPPHNIRKSKEAKKGAKFRHPVALDLAPQRSSVRRSFGRSKRFSITRSLDDLESAT
VSDGELNSSDLKDCISDNSLSSNASLPSVQSCRRLRERRIASWAVSFERLLQDPVGVRYF
SEFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFTKFLCSKATTPVNIDSQAQ
LADDILSAPHPDMFKEQQLQIFNLMKFDSYTRFLKSPLYQECILAEVEGRPLPDPQHVPS
SPTSKHSISSERSHISTPKKLIGKSKSGRSLNEESGEDDAEKKKKGTFFSWTRSKSVGRS
QKKKENDDYQNDSMHTNGLFCRRESQGSMSSAASLELSEVSRVSASVPDKEKSSKYCCIN
LPDGSSCKMIVKSGFSVKEMLSGLCEKHGINIAAVDLFLVGGDKPLVLHQDSSILDSRDL
RLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLNELVAKLNGEQEPLDL
GVPISNLDGQRVVLDEKEPTKGRVFTDRQKGTSVKQSTVVTSTSRNQASTGEGRTLGKSN
SIKIKGENGKNARDARLSKREESLAKIGGKKYQKINLDEAEEFFELISKAQSNRADDQRG
LLRKEDLILPDFLRLPPSGPEPSSSTPMSSKGLSKRIAKSDKCTQLSGKLASVQNCNENS
IKKTGHSENKSALTTFNTQKTYVPFSAPLSPVPHVQENNTIWKRQSRELQAEDIQTIDDE
NVADLTLVAEGDISSPNSTLLPPTPLSDISKLTGANYPSPTPLTGNQENSGYQRSNSGMN
HRKKKDSPGASGNFSEQSTHKTKTNRSLNPPGGGLANRMAPC
Download sequence
Identical sequences K7G9B5
ENSPSIP00000016876 ENSPSIP00000016876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]