SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000017071 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000017071
Domain Number 1 Region: 623-686,727-824
Classification Level Classification E-value
Superfamily PH domain-like 7.4e-31
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 
Domain Number 2 Region: 831-957
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 3 Region: 1247-1378
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-18
Family Second domain of FERM 0.007
Further Details:      
 
Domain Number 4 Region: 1147-1224
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000429
Family Ubiquitin-related 0.051
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000017071
Domain Number - Region: 1379-1465
Classification Level Classification E-value
Superfamily PH domain-like 0.0369
Family Third domain of FERM 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000017071   Gene: ENSPSIG00000014956   Transcript: ENSPSIT00000017149
Sequence length 1528
Comment pep:novel scaffold:PelSin_1.0:JH206102.1:126971:215300:1 gene:ENSPSIG00000014956 transcript:ENSPSIT00000017149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELAMENGSCMDWQKRCLALETQLFKFRLQASKIRELLAEKAVKMQELEQRVIEAEQRA
ENAEKQVRVMEEKVKLDNMKTSESESTLYRKYQELLGTVQGKDDLISRLEMQLEQQKQLR
AEEAKIIQDKAAKIKEWVTFKLRELELDNYHLKNCNQRLTEQIEALQDALQVQTDSWISC
LGGGYCCQGIFSPPFTCFSSEFLSSPLAVYTDRMAAFLQSYTDVVPSPCVSIWHFEVPRT
PLRSFQRQHSMERRKVPRTLLSSLLEKPAQNSFLLGMGVKQECQGRAKHVPPTPTTILVD
EASLAKEASKSLSSQNMLRVIPDSSNWKPTVEKDAFCTVISDTSSGCPDPTLQDPTVEST
SVLDALAFQSSLGRNQNSLSTLEQRASELGNSSDELSAKFRSHRLDSSSSGEISIPYGCL
PTAEPRLGLPSSITSTQPSFPGRECGLSNSMTLPKIRTPSSPRDSIQLAKRHYSQPQPGA
HRFHHITSIEIGTFQPITASTLCPAPVEETDIDGDDLLEKMETEGCPVGEETGMGVETDQ
HPGSGKNECGNSEAGPLDRGGKPPTPPLHRFPSWESRIYAVAKSGMRLSEVALGTNSPSW
ILNFPSYSNSGPFTGLIYRNVTVPVYSTLKGKATQISNIPFLDESSGSDDDCSSHASIRT
SNGGSEIRKSSTPGSPRAMKRGVSMSSLSSESDYAIPPDAYSLDGDYSEPEHKLQRTSSY
STDGGVCSEPMEKSGYLLKMGSQVKTWKRRWFVLRNGQIMYYKSPSDVIRKPQGQAELNS
SCQIIRGEGSQTFQLITEKRTYFLTADSPNILEEWIRVLQSILKVQVTSSAALPQKDAKP
TVKGWLTKVKHGHSKLVWCALIGKAFFYYRNNEDKCPLGHLYIRKSKVEEVDRSCDSDED
YEATAGGLLSSHYTLVIHPQDQSPTYLLIGTKHEKDTWLYHLTVAAGSSNAKVGTAYEQL
IGKLLDAEGDPQSPLWKHPMLCYSKDGLHTSLTTLPSEALQTEALKLFKSCQLFINVPVE
APSIDYHVSLAQTALQVCLTHAELQNEIYCQLVKQTSCRQPRNHSVIQCWQLLALCAPLF
LPQHHFLWYIKQHLQRHADPRIRSEIGKYAIYCQRSVERTLHTGEREAKPSRMEIVSILL
RNPFHHSLPFSIPVHFMNGTYQVVGFDGSSTVDEFLQRLNQETGMRKLSHTGFSLFTDDP
SGKDLEHCLQGTVKICDVISKWEQAFKELHPGKYEGSTRIVKLTYKSRLYFRNQAKGETD
RERLLLAFQISCEIANGRFPVNKELALEMVALMAQVEYGDSDRPVSSSPGGTPQSKMQHI
VQQVLDKFYPKRYKQNITPEHLRRLADKLATKWMVLQGCSPLECIRIYLAVARKWPLFGA
KVFAAKPALPSLLEDCPVWIAVNEDGISILDYNTMHLKLSYPYSSVLTFGGCRDDFMIVV
SQGKDRSSGKNSTEKLLFTMAAPKIVEVTLLIASYINYCALTPLLSPAPPSLSVISPLST
TPTKKLWETQSQCFFPSVPRTTKGPTLL
Download sequence
Identical sequences K7G9W0
ENSPSIP00000017071 ENSPSIP00000017071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]