SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000017864 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000017864
Domain Number 1 Region: 663-793
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.1e-46
Family Regulator of G-protein signaling, RGS 0.00000628
Further Details:      
 
Domain Number 2 Region: 271-374
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000135
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000017864
Domain Number - Region: 13-61
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000216
Family PDZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000017864   Gene: ENSPSIG00000015826   Transcript: ENSPSIT00000017946
Sequence length 799
Comment pep:novel scaffold:PelSin_1.0:JH211144.1:102953:197472:1 gene:ENSPSIG00000015826 transcript:ENSPSIT00000017946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRFNGLCKVCSERRYRQITIPRGRDGFGFTICCDSPVRVQAVDSGKRTTTAGLRQQQRL
LFDTKMVSTRFFLIAHCVRKMCYVRRTPPRQIFLILALALAERSPPPNMQTKYQQTPALT
LLAFSLGENPVGQTGRHQGARPRPHTQRCPTPKSQSCSVCDQGWSCRSPGCPRRAREVRS
PGSRAEGDWVTRPCLLCVFQLLRPVYQEQDAAVGSAGKGKSHAGSGRKSRLMKTVQSMKS
YGNYQNCTVVRPHVPHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLHEGR
SKTLKVTVFVYSDLLLFTKEDEPGRCNVLRNPLYLQSVKLQEGSSEDLTFCILYLAEKSE
CLLRLEAHSQEQKERLCWCLAENIGKQQPPAAAPAENKVLPMQAPSPGQQREEEKVAEGG
DASSAPEGEPEGVLTEAIPAAPLEEKEVETGARHAEKQPGSSPAFVIPELRLDSTFSQGA
ESVAEGPSGEEDEDEEEEEEEEEDSAQHYLEGNEVKRCSMIEPPGCEEACTLTLQGSLRR
RTHSEGSLLQEAKGHYFTSDTTLHCLESQHSQARWALPSPRTLKKELTKNGGYSHQLGLL
FSGHRKLSGSDDCSCEDGDEASCKKRSKNLAKDMKNRLGIFRRRNESPGGNPKLDKAVKS
LKPSPEEALKWGESLERLLHQKYGLAAFRAFLRTEFSEENLEFWLACEEYKKIKSQSKMV
SKAKKVFAEYIAIQSCKEVNLDSYTRDHTKENLQTVTRSCFDLAQKRIYGLMEKDPYPRF
LRSELYLDLIHQKKSSPSL
Download sequence
Identical sequences K7GC53
ENSPSIP00000017864 ENSPSIP00000017864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]