SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000017911 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000017911
Domain Number 1 Region: 30-124
Classification Level Classification E-value
Superfamily Fibronectin type III 2.11e-27
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 110-229
Classification Level Classification E-value
Superfamily Fibronectin type III 6.45e-26
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000017911   Gene: ENSPSIG00000015877   Transcript: ENSPSIT00000017994
Sequence length 231
Comment pep:novel scaffold:PelSin_1.0:JH205754.1:3375720:3381195:1 gene:ENSPSIG00000015877 transcript:ENSPSIT00000017994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLIKHYPLYLLINLLWTGATGHRELQRLIKPLKVEFHALNLNSTLHWQPGSDAAGDITYF
VQYKVYGQNLWKNKEECWGIREVFCDLTHETSDIREPYYGRVKSVSAGVHSDWNTSSRFT
PWRETKIGPPSLKVTPRNKSIQLKLRAPNSPYKRRRGSKIPMTNYYDLLYRVFLISNMLD
EKQKILMYEGTDKVVKIEDLKSEVSYCIVVETYLPMLDRSSACSSKICTVP
Download sequence
Identical sequences K7GCA0
ENSPSIP00000017911 ENSPSIP00000017911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]