SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000018016 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000018016
Domain Number 1 Region: 140-236
Classification Level Classification E-value
Superfamily Immunoglobulin 7.46e-25
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 233-331
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 34-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000053
Family I set domains 0.031
Further Details:      
 
Domain Number 4 Region: 416-512
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000803
Family I set domains 0.0087
Further Details:      
 
Domain Number 5 Region: 332-429
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000923
Family I set domains 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000018016
Domain Number - Region: 509-550
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000445
Family Fibronectin type III 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000018016   Gene: ENSPSIG00000016031   Transcript: ENSPSIT00000018099
Sequence length 553
Comment pep:novel scaffold:PelSin_1.0:JH212496.1:370841:443855:1 gene:ENSPSIG00000016031 transcript:ENSPSIT00000018099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGSTMIWYVATLIASVITTRGLPAQGAHGSREEPEFVTARAGESVILGCDVIHPVTGQP
PPYVVEWFKFGVPIPIFIKFGFYPPHVDPEYAGRASLHDKASLRVEQIRSEDQGWYECKV
LMLDQQYDTFHNGSWVHLTVNAPPTFTETPPQYVEAKEGSSITLTCMAFGNPKPIVTWLR
EGDLLGASGKYQVSDGSLTVVSVSRQDRGAYTCRAYSIQGEAVHTTRLLVQGPPFIVSPP
ENITVNISQDALFTCQAEAYPGNMTYTWFWEEQNVYFKNDLKLRVRILIDGTLIIFRVKP
DDAGKYTCIPSNSLGRSPSASAYLTVQYPARVVNMPPILYVPIGIHGYIRCPVEAEPPVT
LVKWNKDGRPLRIEKYSGWNLLEDGSIQIEEVTEDALGTYTCVPYNALGTMGQSPPARLV
LKDPPYFTVLPGWEYRQEAGRELLIPCAAAGDPFPVIAWRKVGKPSRSKHNTLPGGSLQF
QSLSKDDHGEWECVATNVVTSITANTHLTVIGTSPHAPGSVHVAVSMTSANVSWEPGYDG
GYEQTFSVWYGPL
Download sequence
Identical sequences K7GCK5
ENSPSIP00000018016 ENSPSIP00000018016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]