SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000018560 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000018560
Domain Number 1 Region: 11-141
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000931
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPSIP00000018560
Domain Number - Region: 370-410
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000202
Family PDZ domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000018560   Gene: ENSPSIG00000016480   Transcript: ENSPSIT00000018646
Sequence length 423
Comment pep:novel scaffold:PelSin_1.0:JH212492.1:2137927:2160079:-1 gene:ENSPSIG00000016480 transcript:ENSPSIT00000018646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGSQATFFQGEEICKQGEFIKSPPPQLFTSQGSWKKRYFILCKPSKRCYMLKYLKGQQI
KGSIAIDQISNVEIGINNYEKMTAIRKMFKCCPEEVISINTESRDYYLIGKDREQVEDWM
TSLSLARAETTENGYSTQLTCSHGRKHNKQASKKTNKPSHCPDHANYSSVRNWISTKQKQ
NNSSEETRKSQLLLHSDGNTNEKGEEYYAFPSSILAQLESEQATSDSPIHSHNLMETGDH
LSRKLYLSMKALFPEEKLQPTHRSDESLTIPRSQANSVHWGNSEADGNQQQLMQSSTSKQ
LPQKRKPNSSPLSVVQLSIIINKIKDSSQLQEVDICIPHADLTSNLILIEAAGQICVSQW
RGPPRLGCLFHHGDHIVAVNDLRIHSIEELSLFISKSVKKEKVKLTICRIPDSAIFHIKG
CSC
Download sequence
Identical sequences K7GE49
ENSPSIP00000018560 ENSPSIP00000018560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]