SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019187 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019187
Domain Number 1 Region: 55-145
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-24
Family PDZ domain 0.0019
Further Details:      
 
Domain Number 2 Region: 189-272
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000401
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 309-398
Classification Level Classification E-value
Superfamily PH domain-like 0.00000186
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019187   Gene: ENSPSIG00000017001   Transcript: ENSPSIT00000019277
Sequence length 525
Comment pep:novel scaffold:PelSin_1.0:JH205572.1:1800094:2062596:1 gene:ENSPSIG00000017001 transcript:ENSPSIT00000019277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLLYLSKFFSLFLPLKTKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFY
SGERTVTIRRQTVGGFGLSIKGGAEHNIPVVISKISKEQRAELSGLLFIGDAILQINGIN
VRKCRHEEVVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACVPSDQSSGTSSPLCDS
GLHLNYHPNNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYLPGSDLCRQNAFQ
VIAVDGVCSGIIQSLSAEDCMDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWTEE
REQDSLQDRMYTPKFLALRGSSLYKFIAPPVTTWDWTRAEKTFSVYEIMCKILKDSDLLD
RRKHCFGVQSESGEDLYFSVELECDLTLWEKAFQTATFLEVERIQCKTYACVLESHLMGL
TIDFGMGFVCFDAATKAVLWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNL
FAVLHCIHSFFAAKVACLDPLYVGSQATTSAVATTSGTGKLKYTT
Download sequence
Identical sequences K7GFX6
ENSPSIP00000019187 ENSPSIP00000019187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]