SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019346 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019346
Domain Number 1 Region: 199-351
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 90-197
Classification Level Classification E-value
Superfamily Second domain of FERM 3.66e-22
Family Second domain of FERM 0.002
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-20
Family First domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019346   Gene: ENSPSIG00000017130   Transcript: ENSPSIT00000019436
Sequence length 980
Comment pep:novel scaffold:PelSin_1.0:JH207986.1:5432278:5648368:-1 gene:ENSPSIG00000017130 transcript:ENSPSIT00000019436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGRQCQVQLLDDRKLELLVQPKLLSRELLDLVASHFNLKEKEYFGITFIDDTGQNIWL
QLDHRVLDHDLPKKPGPATLYFAVRFYIESISFLKDKNTVELFFLNAKSCVHKGHIEVDS
ETIFRLAALILQEAKGDYSSDDNTRKDLKALSAFPTKTLQEHPSLAYCEDRVIEHYIKIK
GLTRGQAIIQYMTVVEALPTYGVHYYGVKDKQGIPWWLGISYKGIGQYDLQDKVKPRKLF
QWKQLENLYFREKKFAVEVHDPRRISVSRRTFGQSGLVVQTWYANTSLIKSIWVMAISQH
QFYLDRKQSKAKIPSARSLDDIAMDLTEMGTPKVAKLVTLESKNQLIMASNGSLISSGSQ
DSEVSEEQKKEKIADLKKKEKLLQEKLLQKVEELKKICLREAELTGTMPKEYPLSVGEKP
PQVRRRVGTTFKLDDNLLPSEEDPTLHSLERNFNIQQKLVEAAKKLASEPDLCKNVKKKR
KQDYTDAMKKLQETENSINEYRIKCGKKPTQKSTLILPDDIIPSESSSLSDTTVYDDAND
SFTAPGQGTSCIQLSPRIPPPKSLGLERIHLRKSSLTEQLLENRHSRDTLSTHSSPYRVL
ERQSQGGRSMPTTPVLTRNAYSSTHLQPDISPEHCRQRSGSLESQTHLLSEPASDKPVFS
LSKSQRSSSTEILDDGSSYTSQSSAEYYCVTPTPSPYYTTQTLDNRTRGRRRSKKQNISA
ASSGSMPNLAQKDPRNSVYQKSQEQPSSSYYVSGYSPYADCDVYYNGGYVYENDTEGQYS
VNPSYRSAAPCVYDRYRELRSYQEGEMERVSHNPYATLRLPRKQVAKTQHITKNIHKALV
AEHLRGWYQRASGQKDPCQSLQAGFDSDRGSQRSLGFAGLQVPCSPSSRASSFSSASSAN
TSGNWRNQIALGLSDYDTLSQASSTSCYGSTYGNLPLQSRVYAERSQLLDDADENQLEAD
LHSNEQRLFWHEDSKPGTLV
Download sequence
Identical sequences K7GGD5
ENSPSIP00000019346 ENSPSIP00000019346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]