SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPSIP00000019402 from Pelodiscus sinensis 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPSIP00000019402
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-58
Family DBL homology domain (DH-domain) 0.0000175
Further Details:      
 
Domain Number 2 Region: 221-362
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-33
Family Pleckstrin-homology domain (PH domain) 0.00059
Further Details:      
 
Domain Number 3 Region: 382-492
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.58e-28
Family DEP domain 0.0026
Further Details:      
 
Domain Number 4 Region: 477-606
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.25e-28
Family DEP domain 0.0011
Further Details:      
 
Domain Number 5 Region: 677-743
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000276
Family PDZ domain 0.018
Further Details:      
 
Domain Number 6 Region: 581-671
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000116
Family PDZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPSIP00000019402   Gene: ENSPSIG00000017094   Transcript: ENSPSIT00000019493
Sequence length 1606
Comment pep:novel scaffold:PelSin_1.0:JH211036.1:1300318:1567918:1 gene:ENSPSIG00000017094 transcript:ENSPSIT00000019493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEESKGEGKGESGKDLEKQLRLRVCVLSELLKTERDYVGTLEFLVSAFLQRMIQCAASK
VDKNVTEETVKMLFSNIEDVLAVHKDFLTLVEECLHPEPNAYHEVGICFLRFKDRFCIYD
EYCSNHEKAQKLLLELNKIRTVRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLL
KELLKRTPKKHSDYAVLMEALQTMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT
DTCTEMLMYGVLLKISAGNIQERVFFLFDNLLVYCKRKHRRLKNSKASTDGHRYLFRGRI
NTEVMEVENVDDGTADYHSSGHLVVNGWKIHNTAKNKWFVCMAKTPEEKQEWLEAILKER
ERRKGLKLGMEQDTWVMISEQGEKLYKMMCKQGNLIKDRKRKLTTFPKCFLGSEFVSWLL
EIGEIHKSEEGVNLGQALLENGIIHHVTDKHQFKPEHMLYRFRYDDGTYYPRSEMQDVIS
KGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC
DNGFMHHVLEKSEFKDEPLLFRFFADEEMEGSNMKHRLMKHDLKVVENVIAKSLLVKSNE
GSYGFGLEDKNKVPIIKIVEKGSNAEMAGLEVGKKIFSINGDLVFLRPFNEVDCFLKACL
NSRRPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAATAGLHPGQCII
KVNGINVSKETHASVIAHLTACRKYRRPMQQDSIQWVYNSTESAQEDLQKANSKPPGDEG
GDAFDCKVEEVIDKFNTMAIIDGRKDHVSLTVDNVHLEYGVVYEYDSTAGIKCHVVEKMI
EPKGFFSLTAKILEALAKSDEHFVQNCNSLNSLNEVIPTDLQSRFSVICSEKIEHIYRRI
SSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHINVMEVSYPKTSTSLGSAFGV
QLDSRKHSSHEKENRNSEQGKLSPMVYIQHTITTMAAPSGHSLGQQEGHGLRYLLKEEDL
ETQDVYQKLLGKLQTALKEVEMCVSQIDDLLSSITYSPKSERKTSEPLIPADSDNEKGER
NGKRVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIASFTSICSSQCSSYFHSDEMDS
GDELPLSIRISHDKQDKLHSCLEHLFGQVDSIVNLLKGPAVMRAFEQTKFFTPGRGLQEF
QQEMEPKLSCPKRLRLHIKQDPWNLPSSVQNLAQNIRKFVEEVKTRILLALLEYTDSEIQ
LRRDMVFCQSLVATVCAFSEQLMAALNQMFDNSKEYEMETREASRRWLEQIANAGVLLHF
QSLLSPNLTDEQAMLEDTLVALFDLEKVTFYFRQSEPEPLVANVPITYQAEGSRQALKVY
FYLDSYHFEQLPQRLKNGGGFKIQPVLFAQALESMEGYYYRDNVSVEEFQAQINAASLEK
VKQYNQKLRAFYLDRTNLPPNSTSKAAYIDKLMRPLNSLDELYRLVVSFIRSKRTAACAY
TACSASGVGLLSVSSELCSRLGACHIIMCNSGVHRCTLSVTLEQAIILARCHGLPPRYIM
QATDVMRKQGARVQNTAKNLGVRDRTPQSVPRLYKLCQPPPPAGEE
Download sequence
Identical sequences K7GGJ1
XP_006131552.1.96668 ENSPSIP00000019402 ENSPSIP00000019402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]